Align Prephenate dehydrogenase protein; EC 1.3.1.12 (characterized, see rationale)
to candidate RR42_RS04470 RR42_RS04470 prephenate dehydrogenase
Query= uniprot:D8IR44_HERSS (295 letters) >FitnessBrowser__Cup4G11:RR42_RS04470 Length = 302 Score = 314 bits (805), Expect = 1e-90 Identities = 162/284 (57%), Positives = 202/284 (71%), Gaps = 1/284 (0%) Query: 2 FKKVVIFGVGLIGGSFALALRRAGQAAHIVGVGRSLQSLERARELGIIDAVATDAASAVQ 61 F +VVI GVGLIGGS ALAL+RAG +VGVGRS SLERA +LG+ID AT A + Sbjct: 10 FSRVVIVGVGLIGGSLALALKRAGAVGTVVGVGRSQASLERALKLGVIDEAAT-LEDAAK 68 Query: 62 GADLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQFIPAH 121 GA +I++ APVAQT +L ++ PHLEP I+TDAGSTKSDV+ AA+ ALGD+ QF+PAH Sbjct: 69 GASMIVLCAPVAQTFALLHALEPHLEPATIITDAGSTKSDVIMAAKTALGDKAAQFVPAH 128 Query: 122 PIAGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQEHDA 181 PIAGRE HG EAAL +LY GKKVV+ L EN DV V A W GA +S +HDA Sbjct: 129 PIAGRELHGVEAALDDLYVGKKVVLCPLQENTRIDVAGVRAMWETAGAQCSVMSAVQHDA 188 Query: 182 VFASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLANRD 241 VFA+VSHLPH+L++ALV +A AA +A GFRDFTRIAASSPEMWRDI + NR+ Sbjct: 189 VFAAVSHLPHLLSYALVAQVANAEDAALKLDFAGGGFRDFTRIAASSPEMWRDICVGNRE 248 Query: 242 ALLTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQQWAA 285 A+L+E+ Y L +++ +I +G G+E+I+ A ARQQW A Sbjct: 249 AMLSELSTYQAMLAHLKTLIENSNGEGLERIFQRASQARQQWGA 292 Lambda K H 0.320 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 302 Length adjustment: 27 Effective length of query: 268 Effective length of database: 275 Effective search space: 73700 Effective search space used: 73700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory