Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate 3610091 Dshi_3472 Argininosuccinate synthase (RefSeq)
Query= SwissProt::P59846 (400 letters) >FitnessBrowser__Dino:3610091 Length = 406 Score = 502 bits (1292), Expect = e-147 Identities = 251/393 (63%), Positives = 301/393 (76%), Gaps = 3/393 (0%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALDL 61 K+VLAYSGGLDTSIILKWL+ Y EV+ FTAD+GQGEE+E AR KA GAS DL Sbjct: 6 KVVLAYSGGLDTSIILKWLQTEYDCEVVTFTADLGQGEELEPARAKAEMMGASAIYIEDL 65 Query: 62 KEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGND 121 +EEFVRDFVFPM RA AVYEG YLLGTSIARPLI+K LV IAE EGA+A+AHGATGKGND Sbjct: 66 REEFVRDFVFPMFRANAVYEGLYLLGTSIARPLISKRLVEIAEAEGADAVAHGATGKGND 125 Query: 122 QVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQ--EKPYSMDANLL 179 QVRFEL AYAL PDIKVIAPWREW R ++I +AE H IP+ + E P+S+DANLL Sbjct: 126 QVRFELAAYALNPDIKVIAPWREWDLSSRTKLIDFAEKHQIPIAKDKRGEAPFSVDANLL 185 Query: 180 HISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALL 239 H S EG VLEDP + P +++ T +PE+AP+ PEY+EV F GD V++NGE +SPA +L Sbjct: 186 HTSSEGKVLEDPAEDAPDYVYQRTVNPEDAPNTPEYIEVGFERGDAVSINGEAMSPATVL 245 Query: 240 QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRD 299 +LNE+GG HG+GR+D+VE RFVGMKSRG+YETPGGTIL A R +E +TLDR H +D Sbjct: 246 TKLNELGGAHGIGRLDLVEGRFVGMKSRGIYETPGGTILLEAHRGIEQITLDRGAAHLKD 305 Query: 300 MLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYR 359 L P+YAEL+Y GFW++PERE LQA D VTG RLKLYKG+V VGR + SLY Sbjct: 306 ELMPRYAELIYNGFWFSPEREMLQAAIDASQAHVTGTVRLKLYKGSVRTVGRWSDHSLYS 365 Query: 360 QDLVSF-DEAGGYDQKDAEGFIKIQALRLRVRA 391 + V+F D+AG YDQKDA GFI++ ALRL++ A Sbjct: 366 EAHVTFEDDAGAYDQKDAAGFIQLNALRLKLLA 398 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 406 Length adjustment: 31 Effective length of query: 369 Effective length of database: 375 Effective search space: 138375 Effective search space used: 138375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 3610091 Dshi_3472 (Argininosuccinate synthase (RefSeq))
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.28482.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-147 475.9 0.0 7.3e-147 475.7 0.0 1.0 1 lcl|FitnessBrowser__Dino:3610091 Dshi_3472 Argininosuccinate synt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3610091 Dshi_3472 Argininosuccinate synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 475.7 0.0 7.3e-147 7.3e-147 1 390 [. 6 398 .. 6 402 .. 0.98 Alignments for each domain: == domain 1 score: 475.7 bits; conditional E-value: 7.3e-147 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGaekayviDareefvkdylfaaiqan 76 kvvlaysGGlDts++lk+l+ + +ev+++t+d+Gq+ e+l+ ++ ka +Ga y+ D reefv+d++f+ +an lcl|FitnessBrowser__Dino:3610091 6 KVVLAYSGGLDTSIILKWLQTEyDCEVVTFTADLGQG-EELEPARAKAEMMGASAIYIEDLREEFVRDFVFPMFRAN 81 8*********************999***********9.9************************************** PP TIGR00032 77 avyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlkviaPvreleli.Reeei 152 avyeg Yll+t++aRpli+k+lve+a+ ega+avahG+tgKGnDqvRFel ++lnpd+kviaP+re++l+ R+++i lcl|FitnessBrowser__Dino:3610091 82 AVYEGLYLLGTSIARPLISKRLVEIAEAEGADAVAHGATGKGNDQVRFELAAYALNPDIKVIAPWREWDLSsRTKLI 158 **********************************************************************99***** PP TIGR00032 153 eyaaekGievpvek..ekaysiDenllgrsiEageLEdpsteppediyelvkdpiektedepevveieFekGvPval 227 ++a+++ i+++ +k e ++s+D nll+ s E++ LEdp p+ +y+ +++p++++ ++pe++e++Fe+G v++ lcl|FitnessBrowser__Dino:3610091 159 DFAEKHQIPIAKDKrgEAPFSVDANLLHTSSEGKVLEDPAEDAPDYVYQRTVNPEDAP-NTPEYIEVGFERGDAVSI 234 **********99875579**********************************999888.9***************** PP TIGR00032 228 ngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiYEapalllLikAhkdLetlvltkdvlefkeiveeky 304 nge ++p +++ k+ne++g+hG+Gr+D vE R +g+KsR+iYE+p+ ++L++Ah+ +e+ +l++ +++k+ +y lcl|FitnessBrowser__Dino:3610091 235 NGEAMSPATVLTKLNELGGAHGIGRLDLVEGRFVGMKSRGIYETPGGTILLEAHRGIEQITLDRGAAHLKDELMPRY 311 ***************************************************************************** PP TIGR00032 305 seliYkGlwfdplaealdalikktqervtGtvrvklfkGnaivigrkseyslYdeelvsfek.dkefdqkdaiGfik 380 +eliY+G+wf+p++e+l+a+i+ +q +vtGtvr+kl+kG+++++gr s++slY+e v+fe ++dqkda+Gfi+ lcl|FitnessBrowser__Dino:3610091 312 AELIYNGFWFSPEREMLQAAIDASQAHVTGTVRLKLYKGSVRTVGRWSDHSLYSEAHVTFEDdAGAYDQKDAAGFIQ 388 *************************************************************944589********** PP TIGR00032 381 irglqikvyr 390 +++l+ k + lcl|FitnessBrowser__Dino:3610091 389 LNALRLKLLA 398 ****999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (406 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.58 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory