GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisN in Dinoroseobacter shibae DFL-12

Align Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (characterized)
to candidate 3609389 Dshi_2774 histidinol-phosphate phosphatase, putative (RefSeq)

Query= reanno::Phaeo:GFF2154
         (250 letters)



>lcl|FitnessBrowser__Dino:3609389 Dshi_2774 histidinol-phosphate
           phosphatase, putative (RefSeq)
          Length = 273

 Score =  310 bits (795), Expect = 1e-89
 Identities = 160/249 (64%), Positives = 186/249 (74%), Gaps = 1/249 (0%)

Query: 1   MADAARQAILPYFRSAGLQSDNKLD-EGFDPVTIADRAAEQAMRSVLSELRPEDSILGEE 59
           +A AAR   L  FR  GL  +NK     FDPVT ADRAAE+AMR +L+  RP+D ILGEE
Sbjct: 22  LAQAARGPTLAQFRQHGLGIENKAGVAAFDPVTEADRAAERAMRDLLAVERPDDGILGEE 81

Query: 60  FGETHGQSGRTWVLDPIDGTRGFISGTPTWGVLIALGDADGPFLGIVDQPYIGERFIGTP 119
           +G   G SG TWVLDPIDGTR ++SGTPTWGVLIAL D DGP +GI+DQPY  ERF+G  
Sbjct: 82  YGAQAGTSGLTWVLDPIDGTRAYMSGTPTWGVLIALSDRDGPRIGIIDQPYTAERFMGGA 141

Query: 120 EGASLTGPLGHSALVTRATDSLSEATLFTTFPEVGTEAERAAFQRVSAQVRLTRYGMDCY 179
             A L GP G   L TR    LSEAT+FTTFPE+GT AERA F+ V+   RLTR+GMDCY
Sbjct: 142 GRARLDGPHGSLPLATRRVAGLSEATVFTTFPEIGTAAERAGFEAVARVCRLTRFGMDCY 201

Query: 180 AYALLAAGQCDLVIEAGLNAYDIQAPIAVIQAAGGVVTNWQGEPAHEGGQVLAAATAELH 239
           AY LLAAGQ DLVIEAGL  YDI APIAVI+AAGG+VT+WQG PAH GG+VLAA   E+H
Sbjct: 202 AYGLLAAGQIDLVIEAGLQPYDICAPIAVIEAAGGIVTDWQGGPAHGGGRVLAAGGPEVH 261

Query: 240 AAALALIQQ 248
           AAAL ++++
Sbjct: 262 AAALEILRK 270


Lambda     K      H
   0.317    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 304
Number of extensions: 12
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 250
Length of database: 273
Length adjustment: 25
Effective length of query: 225
Effective length of database: 248
Effective search space:    55800
Effective search space used:    55800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate 3609389 Dshi_2774 (histidinol-phosphate phosphatase, putative (RefSeq))
to HMM TIGR02067 (hisN: histidinol-phosphatase (EC 3.1.3.15))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR02067.hmm
# target sequence database:        /tmp/gapView.23316.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02067  [M=252]
Accession:   TIGR02067
Description: his_9_HisN: histidinol-phosphatase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
    5.1e-87  277.5   0.1    5.9e-87  277.3   0.1    1.0  1  lcl|FitnessBrowser__Dino:3609389  Dshi_2774 histidinol-phosphate p


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dino:3609389  Dshi_2774 histidinol-phosphate phosphatase, putative (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  277.3   0.1   5.9e-87   5.9e-87       3     251 ..      17     268 ..      15     269 .. 0.98

  Alignments for each domain:
  == domain 1  score: 277.3 bits;  conditional E-value: 5.9e-87
                         TIGR02067   3 alalelaeaageailkyfrasdlkvdkksdk...tpVteADraaEeaireliaakfPddgilGEEfgeeeedaeyvW 76 
                                       ++a++la+aa+  +l  fr++ l  ++k+     +pVteADraaE+a+r+l+a ++PddgilGEE+g+++++++ +W
  lcl|FitnessBrowser__Dino:3609389  17 QVAEALAQAARGPTLAQFRQHGLGIENKAGVaafDPVTEADRAAERAMRDLLAVERPDDGILGEEYGAQAGTSGLTW 93 
                                       6899*******************99999988899******************************************* PP

                         TIGR02067  77 vlDPiDGTksFirGvPvwgtLiaLlekgkpvlGvisqPalgerfvaakgegallng.gerelrvsevaklsdAvlvt 152
                                       vlDPiDGT+++++G P wg+LiaL + + p +G+i+qP++ erf++ +g++ l  + g+ +l++++va ls+A+++t
  lcl|FitnessBrowser__Dino:3609389  94 VLDPIDGTRAYMSGTPTWGVLIALSDRDGPRIGIIDQPYTAERFMGGAGRARLDGPhGSLPLATRRVAGLSEATVFT 170
                                       *****************************************************998666****************** PP

                         TIGR02067 153 tspkaledeeereafeklrrkarltryggdcyayalvAsGrvdlvveaelspyDiaalipiieeAggvitdwkGkea 229
                                       t p ++ + +er+ fe+++r +rltr+g dcyay l+A+G++dlv+ea+l+pyDi+a i +ie Agg++tdw+G +a
  lcl|FitnessBrowser__Dino:3609389 171 TFP-EIGTAAERAGFEAVARVCRLTRFGMDCYAYGLLAAGQIDLVIEAGLQPYDICAPIAVIEAAGGIVTDWQGGPA 246
                                       ***.8************************************************************************ PP

                         TIGR02067 230 eeggeavaaanaalhdevlell 251
                                       + gg+++aa+ +++h+++le+l
  lcl|FitnessBrowser__Dino:3609389 247 HGGGRVLAAGGPEVHAAALEIL 268
                                       ********************98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (252 nodes)
Target sequences:                          1  (273 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 9.62
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory