Align acetohydroxyacid isomeroreductase (EC 1.1.1.86) (characterized)
to candidate 3609007 Dshi_2396 ketol-acid reductoisomerase (RefSeq)
Query= metacyc::MONOMER-18814 (338 letters) >lcl|FitnessBrowser__Dino:3609007 Dshi_2396 ketol-acid reductoisomerase (RefSeq) Length = 340 Score = 456 bits (1174), Expect = e-133 Identities = 227/340 (66%), Positives = 267/340 (78%), Gaps = 2/340 (0%) Query: 1 MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDSGV-NVTVGLRKSGASWNKAANA 59 M+V+YD+D D++LIK K V I+GYGSQGHAHALNL+DSG N+ V LR+ AS KA Sbjct: 1 MRVYYDRDCDVNLIKDKKVAILGYGSQGHAHALNLRDSGAKNLVVALREGSASAKKAEAE 60 Query: 60 GLQVKEVAEAVKGADVVMILLPDEQIADVYKNEVHDNIKEGAALAFAHGFNVHYGAVIPR 119 GLQV +AEA D++M +PDE A+ YK VHDNI+EGAA+AFAHG NVH+G + P+ Sbjct: 61 GLQVMGIAEAAAWCDLIMFTMPDELQAETYKKYVHDNIREGAAIAFAHGLNVHFGLIEPK 120 Query: 120 ADLDVIMIAPKAPGHTVRATYTQGGGVPHLIAVHQNKSGAARDIALSYATANGGGRAGII 179 A +DVIM+APK PGHTVR YT+GGGVP L+AV + +G A +I LSY +A GGGR+GII Sbjct: 121 AGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAVDTDATGRALEIGLSYCSAIGGGRSGII 180 Query: 180 ETNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIY 239 ETNFREE ETDLFGEQAVLCGG VELI+ GFETLVEAGYAPEMAYFECLHE+KLIVDLIY Sbjct: 181 ETNFREECETDLFGEQAVLCGGLVELIRMGFETLVEAGYAPEMAYFECLHEVKLIVDLIY 240 Query: 240 EGGIANMNYSISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQTGEYAKSFLLENKAGA 298 EGGIANMNYSISN AEYGEYV+GPRV+ +ETK MK LTDIQTG++ + F+ EN G Sbjct: 241 EGGIANMNYSISNTAEYGEYVSGPRVLPYDETKARMKAILTDIQTGKFVRDFMQENTVGQ 300 Query: 299 PTLISRRRLTAEHQIEEVGAKLRAMMPWIAKNKMVDQSKN 338 P RRL EHQIE VG +LR MMPWI+ K+VDQ KN Sbjct: 301 PFFKGTRRLNDEHQIEAVGKELRGMMPWISAGKLVDQEKN 340 Lambda K H 0.316 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 340 Length adjustment: 28 Effective length of query: 310 Effective length of database: 312 Effective search space: 96720 Effective search space used: 96720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate 3609007 Dshi_2396 (ketol-acid reductoisomerase (RefSeq))
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.586.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-127 408.3 0.2 1e-126 408.1 0.2 1.0 1 lcl|FitnessBrowser__Dino:3609007 Dshi_2396 ketol-acid reductoisom Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3609007 Dshi_2396 ketol-acid reductoisomerase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 408.1 0.2 1e-126 1e-126 1 312 [. 14 328 .. 14 330 .. 0.98 Alignments for each domain: == domain 1 score: 408.1 bits; conditional E-value: 1e-126 TIGR00465 1 lkgkkvaiiGyGsqGeaqalnlrdsgl.nvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpDevqkevy 76 +k+kkvai+GyGsqG+a+alnlrdsg n++v+lr+++as kkAe +G++v+ ++ea++ dlim +pDe+q e+y lcl|FitnessBrowser__Dino:3609007 14 IKDKKVAILGYGSQGHAHALNLRDSGAkNLVVALREGSASAKKAEAEGLQVMGIAEAAAWCDLIMFTMPDELQAETY 90 689***********************75799********************************************** PP TIGR00465 77 eaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliAveqdvtgeakeiAla 153 ++ ++++++eg+a+ f+HG n++f i+++++vdv+++APKgpG++vR ey +g Gvp l+Av +d+tg a ei l+ lcl|FitnessBrowser__Dino:3609007 91 KKYVHDNIREGAAIAFAHGLNVHFGLIEPKAGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAVDTDATGRALEIGLS 167 ***************************************************************************** PP TIGR00465 154 yAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqpelAyfeivhelklivdllkekGl 230 y aiGg+r g++et F+eE+e+DLfGEqavLcGgl +li+++f+tLveaGy+pe+Ayfe++he+klivdl++e+G+ lcl|FitnessBrowser__Dino:3609007 168 YCSAIGGGRSGIIETNFREECETDLFGEQAVLCGGLVELIRMGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGI 244 ***************************************************************************** PP TIGR00465 231 elmrdavsntAklgalelr.eil.keelkkemqkilkeiqnGefakewalekeagkpafeearkkekeqeiekvGke 305 ++m ++sntA++g++ ++ ++l +e+k++m+ il +iq+G+f ++++ e+++g+p f+ +r+ + e++ie vGke lcl|FitnessBrowser__Dino:3609007 245 ANMNYSISNTAEYGEYVSGpRVLpYDETKARMKAILTDIQTGKFVRDFMQENTVGQPFFKGTRRLNDEHQIEAVGKE 321 *******************87774589************************************************** PP TIGR00465 306 lralvka 312 lr ++++ lcl|FitnessBrowser__Dino:3609007 322 LRGMMPW 328 *****97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (340 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.03 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory