Align branched-chain amino acid aminotransferase 2; EC 2.6.1.42 (characterized)
to candidate 3609767 Dshi_3150 aminotransferase class IV (RefSeq)
Query= CharProtDB::CH_012531 (298 letters) >FitnessBrowser__Dino:3609767 Length = 284 Score = 140 bits (354), Expect = 3e-38 Identities = 87/275 (31%), Positives = 145/275 (52%), Gaps = 8/275 (2%) Query: 6 IFLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKSIMLEI 65 +++NG+++P+++AK+SV+D G+L+ DGV+E V G + H RL S + + Sbjct: 5 VYVNGDYLPEEDAKISVFDRGFLFADGVYEVTSVLGGKLIDFEGHAKRLERSLSELDMPA 64 Query: 66 PYSLDEITNIVVETIRQNKLSNGYIRLVVSRGAGNLGLDPDSCTKPNVVVIAEQLSLFPQ 125 P ++D + I E + +N++ G + L V+RGA + + KP++V+ + +L Sbjct: 65 PVTMDALLEIHRELVARNEVHEGLVYLQVTRGAADRDFAYPAEPKPSLVLFTQTKTLADA 124 Query: 126 EYYEKGIPVVTVATRR-NRPDVLSPQVKSLNYLNNILVRIEAKLAGVQEALMLNDQGYVA 184 + GI V+++ +R R D +K++ L + ++ AK AGV +A M+ D G V Sbjct: 125 PVAKTGIKVISIEDQRWGRRD-----IKTVQLLYPSMGKMMAKAAGVDDAWMVED-GAVT 178 Query: 185 EGSGDNVFIV-KGNKLITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYVADE 243 EG+ +N +IV K ++T L GITR A+L + V E FT + A E Sbjct: 179 EGTSNNAYIVTKAGTIVTRHLGNEILHGITRAAVLRFAREAQMAVEERSFTIEEAKDAAE 238 Query: 244 VFLTGTAAEVIAVTTVDGRTIGLGQTGPHTNRLLE 278 F+T + V+ V +DG IG G GP RL E Sbjct: 239 AFITSASTFVMPVVELDGAQIGDGTPGPVATRLRE 273 Lambda K H 0.317 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 284 Length adjustment: 26 Effective length of query: 272 Effective length of database: 258 Effective search space: 70176 Effective search space used: 70176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory