Align 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) (characterized)
to candidate 3609657 Dshi_3040 Dihydrodipicolinate reductase (RefSeq)
Query= BRENDA::Q2YJN7 (268 letters) >FitnessBrowser__Dino:3609657 Length = 269 Score = 312 bits (799), Expect = 5e-90 Identities = 159/265 (60%), Positives = 191/265 (72%), Gaps = 1/265 (0%) Query: 2 GLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAITDDP 61 G+VV G GRMG+ LI T++ + A+LVG ER G ++G D G G +GV +TDDP Sbjct: 6 GIVVTGGSGRMGRMLIETVRGSDAARLVGVTERPGHDWIGADIGVALGGAAIGVTVTDDP 65 Query: 62 LPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATIVKS 121 L FA A V+DFTSPAA+V A L AQAR VHVIGTTG S D + AAARHA IV++ Sbjct: 66 LEAFATAQAVIDFTSPAATVAHAELTAQARAVHVIGTTGFSPADLAHLEAAARHAVIVRA 125 Query: 122 GNMSLGVNLLSVLVQKAAEALGPEDFDIEILEMHHRHKVDAPSGTALLLGEAAARGRDIA 181 GNMSLGVNLL L +K A AL D+DIE++E HHRHKVDAPSGTAL+LGEAAA GR +A Sbjct: 126 GNMSLGVNLLVKLTEKVAAALDA-DYDIEVIEAHHRHKVDAPSGTALMLGEAAAAGRGVA 184 Query: 182 LADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGTGERVVLSHHAEDRSIFAR 241 LAD S R RDG TG R+ G IGF+ +RGG ++G+H V+ A GER+ L H A DRS+FAR Sbjct: 185 LADVSDRGRDGITGERKRGDIGFSAIRGGDIVGEHDVLFAAEGERITLRHVASDRSVFAR 244 Query: 242 GAIKAALWAHGKKPGLYSMLDVLGL 266 GA+KAALW K PG Y M+DVLGL Sbjct: 245 GALKAALWGQDKGPGAYDMMDVLGL 269 Lambda K H 0.318 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 269 Length adjustment: 25 Effective length of query: 243 Effective length of database: 244 Effective search space: 59292 Effective search space used: 59292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate 3609657 Dshi_3040 (Dihydrodipicolinate reductase (RefSeq))
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.8304.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-82 261.2 5.1 7e-82 261.0 5.1 1.0 1 lcl|FitnessBrowser__Dino:3609657 Dshi_3040 Dihydrodipicolinate re Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3609657 Dshi_3040 Dihydrodipicolinate reductase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 261.0 5.1 7e-82 7e-82 4 270 .] 7 268 .. 6 268 .. 0.97 Alignments for each domain: == domain 1 score: 261.0 bits; conditional E-value: 7e-82 TIGR00036 4 vavaGaaGrmGrevikavkeaedlelvaalerkgsskqgkDiGelagigkvgvpveddleavkvlaekkadvliDft 80 ++v+G +GrmGr +i++v ++ +lv++ er+g++ g DiG g + +gv+v+dd + +a+ +iDft lcl|FitnessBrowser__Dino:3609657 7 IVVTGGSGRMGRMLIETVRGSDAARLVGVTERPGHDWIGADIGVALGGAAIGVTVTDDPLEA----FATAQAVIDFT 79 89*****************************************************9986544....4677889**** PP TIGR00036 81 tpeavlenvkialekgvrlVvGTTGfseedlkelkdlaekkgvalviapNfaiGvnlllkllekaakvle.dvDiEi 156 p a++ ++++++++ V+GTTGfs +dl++l+++a + + +v a N+++Gvnll+kl+ek+a l+ d+DiE+ lcl|FitnessBrowser__Dino:3609657 80 SPAATVAHAELTAQARAVHVIGTTGFSPADLAHLEAAARH--AVIVRAGNMSLGVNLLVKLTEKVAAALDaDYDIEV 154 **************************************99..999********************99996599**** PP TIGR00036 157 iElHHrhKkDaPSGTAlklaeiiakargkdlkeaaveeregltGerkkeeiGiaavRggdvvgehtvlFasdGerle 233 iE+HHrhK+DaPSGTAl l+e+ a+ rg l ++ +r+g+tGerk+ +iG++a+Rggd+vgeh vlFa +Ger++ lcl|FitnessBrowser__Dino:3609657 155 IEAHHRHKVDAPSGTALMLGEAAAAGRGVALADVSDRGRDGITGERKRGDIGFSAIRGGDIVGEHDVLFAAEGERIT 231 *****************************9*********************************************** PP TIGR00036 234 itHkassRaafakGvvrairwledkeekvydledvld 270 ++H as+R++fa+G+++a+ w +dk + yd+ dvl+ lcl|FitnessBrowser__Dino:3609657 232 LRHVASDRSVFARGALKAALWGQDKGPGAYDMMDVLG 268 ***********************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (269 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.59 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory