Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate 3609935 Dshi_3317 phosphoserine aminotransferase (RefSeq)
Query= BRENDA::P52878 (370 letters) >FitnessBrowser__Dino:3609935 Length = 384 Score = 462 bits (1188), Expect = e-135 Identities = 229/371 (61%), Positives = 270/371 (72%), Gaps = 10/371 (2%) Query: 3 PTRVPNNPCFSSGPCAKHPGYSIEELKDTPFGRSHRSNLGKEKLAEAIKKTRDMLGLPDD 62 P P NP FSSGPCAK P ++++ L D GRSHR+ +GK+KL AI+ TR++LG+P D Sbjct: 6 PVTRPANPRFSSGPCAKPPTWTLDTLGDAALGRSHRATVGKDKLKAAIETTREVLGVPAD 65 Query: 63 YLVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDVRVFEAEYG 122 Y +GIVPASDTGA+EM +WS+LG R V++L WESF GW TD KQLKL D AEYG Sbjct: 66 YKIGIVPASDTGAYEMAMWSLLGERPVEMLAWESFGSGWVTDAIKQLKL-DATTRTAEYG 124 Query: 123 KLPDLKKVDFKNDVVFVWNGTTSGVKVPNGDWIPENREGLTLCDATSAIFAMDIPYHKLD 182 ++ DL VDF DV F WNGTTSGV+VP+GDWIP +R GLTLCDATSA FAMD+ + KLD Sbjct: 125 EIVDLAAVDFDKDVCFTWNGTTSGVRVPDGDWIPADRAGLTLCDATSAAFAMDLAWDKLD 184 Query: 183 VITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTKGGKLNKKIFEGSTI 242 TFSWQKVLGGE AHG+LILSPRAV RLESYTP WPLPKIFRLTKGGKL IF G TI Sbjct: 185 ATTFSWQKVLGGEAAHGILILSPRAVARLESYTPPWPLPKIFRLTKGGKLIDGIFRGETI 244 Query: 243 NTPSMLANEDWLATLKWAESVGGLKPLIQRTNDNLAVFEAFVAKNNWIHFLAETKEIRSS 302 NTPSML ED+L L WA+SVGGL LI R N A AFVA N+WI FLA RS+ Sbjct: 245 NTPSMLCVEDYLFALDWAKSVGGLPGLIARAEANTAAIAAFVAANDWIDFLAADPATRST 304 Query: 303 TSVCFKVDLSDEKL-------KELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATVEKEDL 355 TSVC K +D+++ K + K LE E +A+DIG+YRDAP GLRIWCG TVE D+ Sbjct: 305 TSVCLK--FTDDRIADGAAFAKAVAKRLEAEGIAFDIGAYRDAPPGLRIWCGGTVETSDV 362 Query: 356 QCLCEWIEWAY 366 + L W+ WA+ Sbjct: 363 EALLPWLSWAF 373 Lambda K H 0.318 0.136 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 384 Length adjustment: 30 Effective length of query: 340 Effective length of database: 354 Effective search space: 120360 Effective search space used: 120360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 3609935 Dshi_3317 (phosphoserine aminotransferase (RefSeq))
to HMM TIGR01365 (phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01365.hmm # target sequence database: /tmp/gapView.32620.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01365 [M=374] Accession: TIGR01365 Description: serC_2: phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-194 632.5 1.4 1.4e-194 632.3 1.4 1.0 1 lcl|FitnessBrowser__Dino:3609935 Dshi_3317 phosphoserine aminotra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3609935 Dshi_3317 phosphoserine aminotransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 632.3 1.4 1.4e-194 1.4e-194 1 373 [. 9 375 .. 9 376 .. 0.98 Alignments for each domain: == domain 1 score: 632.3 bits; conditional E-value: 1.4e-194 TIGR01365 1 rpanpefssgpcakrpgysveelknaalgrshrsklgkeklkeaiektrevlevpadyligivaasdtgavemalws 77 rpanp fssgpcak p ++++ l +aalgrshr+ +gk+klk+aie trevl+vpady+igiv+asdtga+ema+ws lcl|FitnessBrowser__Dino:3609935 9 RPANPRFSSGPCAKPPTWTLDTLGDAALGRSHRATVGKDKLKAAIETTREVLGVPADYKIGIVPASDTGAYEMAMWS 85 7**************************************************************************** PP TIGR01365 78 llgargvdllafesfgkgwvtdvtkqlklkdvrvleaeygklpdlkkvdfkkdvvftwngttsgvrvpngdfipadr 154 llg+r+v++la+esfg+gwvtd +kqlkl d aeyg++ dl+ vdf+kdv ftwngttsgvrvp+gd+ipadr lcl|FitnessBrowser__Dino:3609935 86 LLGERPVEMLAWESFGSGWVTDAIKQLKL-DATTRTAEYGEIVDLAAVDFDKDVCFTWNGTTSGVRVPDGDWIPADR 161 ****************************9.566779***************************************** PP TIGR01365 155 eglticdatsaafaqdldyekldvvtfswqkvlggegahgvlilspravarlesytpawplpkifrltkggklskdi 231 glt+cdatsaafa+dl ++kld tfswqkvlgge ahg+lilspravarlesytp wplpkifrltkggkl+++i lcl|FitnessBrowser__Dino:3609935 162 AGLTLCDATSAAFAMDLAWDKLDATTFSWQKVLGGEAAHGILILSPRAVARLESYTPPWPLPKIFRLTKGGKLIDGI 238 ***************************************************************************** PP TIGR01365 232 fegetintpsmlavedaldalkwaesigglkalvaraddnlavleafvaksswvdflaatkeirsntsvclkvvdpd 308 f+getintpsml+ved+l al wa+s+ggl l+ara++n a ++afva ++w+dflaa +++rs+tsvclk++d lcl|FitnessBrowser__Dino:3609935 239 FRGETINTPSMLCVEDYLFALDWAKSVGGLPGLIARAEANTAAIAAFVAANDWIDFLAADPATRSTTSVCLKFTDDR 315 *************************************************************************9998 PP TIGR01365 309 vaaldedaqadfakelvsalekegvaydigsyrdapaglriwcgatveksdleallewldwafal 373 +a d a fak +++ le eg+a+dig+yrdap+glriwcg tve+sd+eall+wl waf++ lcl|FitnessBrowser__Dino:3609935 316 IA----D-GAAFAKAVAKRLEAEGIAFDIGAYRDAPPGLRIWCGGTVETSDVEALLPWLSWAFEA 375 85....3.478****************************************************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (374 nodes) Target sequences: 1 (384 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.67 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory