Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; EC 3.5.1.18; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase (uncharacterized)
to candidate 3606580 Dshi_0012 succinyl-diaminopimelate desuccinylase (RefSeq)
Query= curated2:Q5LN80 (380 letters) >lcl|FitnessBrowser__Dino:3606580 Dshi_0012 succinyl-diaminopimelate desuccinylase (RefSeq) Length = 379 Score = 557 bits (1436), Expect = e-163 Identities = 278/377 (73%), Positives = 306/377 (81%) Query: 4 DAARLTADLIRCASVTPADDGALDVLERVLSQAGFSCTRVDRGGICNLFARWGDKGHARS 63 D LTADLIRC SVTP + GAL +LE LS AGF+CTRVDR GI NLFARWG+KGHARS Sbjct: 3 DPVALTADLIRCPSVTPEEGGALSLLEARLSAAGFACTRVDRNGIANLFARWGEKGHARS 62 Query: 64 FGFNGHTDVVPVGDAAAWTVAPFGAEEKDGFLYGRGATDMKSGVAAFVAAAVDLVTTTPP 123 FGFNGHTDVVPVG A W PFGA+ + ++YGRGA DMKS VAAF AAA+D V TPP Sbjct: 63 FGFNGHTDVVPVGARADWRFDPFGAQVEGDWMYGRGAVDMKSAVAAFAAAAMDFVADTPP 122 Query: 124 EGAVIVTITGDEEGDALDGTKALLDYMAASGERMSVCLVGEPTCPDRMGEMIKIGRRGSM 183 +GAVI+ ITGDEEGDA DGT ALLD+MAA GE M VCLVGEPTCPD MGEM+KIGRRGSM Sbjct: 123 DGAVILAITGDEEGDAKDGTVALLDWMAAQGEAMDVCLVGEPTCPDEMGEMMKIGRRGSM 182 Query: 184 TAWFTVTGVQGHSAYPHRAKNPLPAMARLMDRLASHGLDQGTDHFDPSTLAVVTIDTGNT 243 T +F GVQGHSAYPHRAKNPLPA+A+L+DRLA LD GTDHFDPSTLAV T DTGN Sbjct: 183 TFFFEALGVQGHSAYPHRAKNPLPALAKLVDRLAGLELDTGTDHFDPSTLAVTTFDTGNP 242 Query: 244 ATNVIPAQCRGAVNIRFNDLHSGASLTGWMQGEADRVAEEFGVAVEMKVKISGESFLTPP 303 A NVIPA CR VNIRFND HS SLT ++G A VA E G+ + +V +SGESF+TPP Sbjct: 243 ANNVIPAACRATVNIRFNDAHSSESLTAMVRGIAAEVAAETGIEITDRVSVSGESFITPP 302 Query: 304 GELSDLVAAAVEAETGVTPVLSTSGGTSDARFVKDHCPVVEFGLVGRTMHQVDERVEIAQ 363 G LSDLVAAAVE ETG PVLSTSGGTSDARFV+ HCPVVEFGLVG++MHQVDERV IAQ Sbjct: 303 GRLSDLVAAAVETETGRVPVLSTSGGTSDARFVQHHCPVVEFGLVGKSMHQVDERVAIAQ 362 Query: 364 IHQLKAIYGRILRDFFA 380 I QLKAIY RILRD+FA Sbjct: 363 IPQLKAIYTRILRDYFA 379 Lambda K H 0.319 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 562 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 379 Length adjustment: 30 Effective length of query: 350 Effective length of database: 349 Effective search space: 122150 Effective search space used: 122150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate 3606580 Dshi_0012 (succinyl-diaminopimelate desuccinylase (RefSeq))
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.6167.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-115 372.1 0.0 1.7e-115 371.9 0.0 1.0 1 lcl|FitnessBrowser__Dino:3606580 Dshi_0012 succinyl-diaminopimela Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3606580 Dshi_0012 succinyl-diaminopimelate desuccinylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 371.9 0.0 1.7e-115 1.7e-115 3 368 .. 6 375 .. 4 377 .. 0.96 Alignments for each domain: == domain 1 score: 371.9 bits; conditional E-value: 1.7e-115 TIGR01246 3 elakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgt..eepvlvfaGhtDvvPaGelekWss 77 +l+ +Li+ +svtP++ ga++l+++rL++ gf++ ++ ++++nl+a+ g ++ + f GhtDvvP+G +W+ lcl|FitnessBrowser__Dino:3606580 6 ALTADLIRCPSVTPEEGGALSLLEARLSAAGFACTRVDRNGIANLFARWGEkgHARSFGFNGHTDVVPVGARADWRF 82 6899*******************************************99886677899******************* PP TIGR01246 78 dpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerdelidy 154 dpf ++++ +ygrGa+Dmk+++aaf +aa +fv++ + G + l it Deeg+a+dGt+++++++ ++ e +d lcl|FitnessBrowser__Dino:3606580 83 DPFGAQVEGDWMYGRGAVDMKSAVAAFAAAAMDFVADTPP-DGAVILAITGDEEGDAKDGTVALLDWMAAQGEAMDV 158 ***********************************99875.8*********************************** PP TIGR01246 155 avvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffppsslqia 231 ++vgeP++ +++G+++kiGrrGs+t+ ++ G+qGh aYPh+a+nP++ +++++ +l+ +lD G+++f ps l ++ lcl|FitnessBrowser__Dino:3606580 159 CLVGEPTCPDEMGEMMKIGRRGSMTFFFEALGVQGHSAYPHRAKNPLPALAKLVDRLAGLELDTGTDHFDPSTLAVT 235 ***************************************************************************** PP TIGR01246 232 nieagtgasnviPgelkvkfnlrfssevseeelkskvekildkh....kldYelewklsgepfltkegklikkvaea 304 ++g+ a+nviP++ +++ n+rf+ +s+e+l v+ i + +++ + + ++sge+f+t g+l + va+a lcl|FitnessBrowser__Dino:3606580 236 TFDTGNPANNVIPAACRATVNIRFNDAHSSESLTAMVRGIAAEVaaetGIEITDRVSVSGESFITPPGRLSDLVAAA 312 *********************************999988776654444888888899******************** PP TIGR01246 305 ieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklle 368 +e +++ p lstsGGtsDarf+++ + vve+Glv +++h+v+e+v i+++ +l+++y+++l+ lcl|FitnessBrowser__Dino:3606580 313 VETETGRVPVLSTSGGTSDARFVQHH-CPVVEFGLVGKSMHQVDERVAIAQIPQLKAIYTRILR 375 ***********************998.*********************************9996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.53 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory