Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (characterized)
to candidate 3607752 Dshi_1161 amidohydrolase (RefSeq)
Query= SwissProt::D5E0A1 (375 letters) >FitnessBrowser__Dino:3607752 Length = 386 Score = 218 bits (555), Expect = 2e-61 Identities = 128/364 (35%), Positives = 180/364 (49%), Gaps = 3/364 (0%) Query: 10 RRELHKIPELGFQEVKTQRFLLDYINTLPQERLEVKTWKTGLFVKVHGTNPTKTIGYRAD 69 R+ LH+ PELGF+ KT R+L+ + + + + +G+ + G P IG RAD Sbjct: 18 RQALHRAPELGFECHKTARYLIARLRAFGVDEVHDRIATSGVVALIRGGGPGPVIGLRAD 77 Query: 70 IDGLPITEETNYSFQSQHEGLMHACGHDMHMAIGLGVLTYFAQ-HEIKDNVLFIFQPAEE 128 +D LPI EET ++ S+ EG+MHACGHD HM + LG Y A+ V IFQPAEE Sbjct: 78 MDALPIVEETGVAYASETEGVMHACGHDGHMVMLLGAARYLAETRNFAGTVAIIFQPAEE 137 Query: 129 GPGGAQPMLQSDIMKEWLPDFIFALHVAPEYPVGSIALKEGLLFANTSELFIDLKGKGGH 188 GGAQ M +M+ + + ++ALH AP G G + A I +KG+GGH Sbjct: 138 HGGGAQVMCDEGLMERFGIEHVYALHNAPGIAEGHFLTTRGPIMAAVDTFHIHIKGRGGH 197 Query: 189 AAYPHTTNDMVVAACQLVSQLQTIVARNVDPLDSAVITVGKIQGGTVQNIIAERARIEGT 248 AA PH T D ++AA + LQTIV+RN D V++V +I GT N++ + A I GT Sbjct: 198 AAMPHETADPIMAAVGIAQALQTIVSRNHIATDELVLSVTQIHTGTADNVVPDTAYICGT 257 Query: 249 IRTLSPESMTRVKERIEAIVKGVEVGYQCETAIDYGCMYHQVYNHHEVTREFMEFAKEQT 308 +R+ P V R+E IV G + +DY Y N + A + Sbjct: 258 VRSFDPAVQAMVMRRMEQIVAGQAASFDVMAELDYEKGYPPTVNTADEVALAARAASDVV 317 Query: 309 DVDVIECKEA--MTGEDFGYMLKDIPGFMFWLGVQSEYGLHHAKLQPHEGAIDIAISLIT 366 ++ M EDF YML+ PG +LG GLHH ++ I S Sbjct: 318 GDRAVDTASGRQMGAEDFAYMLQARPGAYLFLGQGEGAGLHHPAYDFNDRIAPIGASFFA 377 Query: 367 KYFE 370 + E Sbjct: 378 RLVE 381 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 386 Length adjustment: 30 Effective length of query: 345 Effective length of database: 356 Effective search space: 122820 Effective search space used: 122820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory