Align homoisocitrate dehydrogenase (EC 1.1.1.87) (characterized)
to candidate 3607360 Dshi_0775 tartrate dehydrogenase (RefSeq)
Query= BRENDA::Q5SIJ1 (334 letters) >FitnessBrowser__Dino:3607360 Length = 359 Score = 220 bits (561), Expect = 4e-62 Identities = 144/356 (40%), Positives = 199/356 (55%), Gaps = 24/356 (6%) Query: 2 AYRICLIEGDGIGHEVIPAARRVLEATG----LPLEFVEAE-AGWETFERRGTSVPEETV 56 AYRI +I GDGIG EV+P +VL A + LEF + A ++ G +P++ Sbjct: 5 AYRIAVIPGDGIGTEVVPEGLKVLTAAARKFDIGLEFETHDFASAAYYQAHGQMMPDDWK 64 Query: 57 EKILSCHATLFGAATSPTRKVP---GFFGAIRYLRRRLDLYANVRPAK-----SRPVPGS 108 +I A FGA P VP +G++ RR D Y N+RP + + P+ G Sbjct: 65 SRIGDSDALYFGAVGWPDM-VPDHVSLWGSLLKFRREFDQYVNLRPVRLMPGVTSPLAGR 123 Query: 109 RPG-VDLVIVRENTEGLYVEQERRYLDVAIADAVISKKASERIG-----RAALRIAEGRP 162 PG +D +VRENTEG Y R + + V+ + R+G R A +A+ RP Sbjct: 124 APGEIDFWVVRENTEGEYSSIGGRIFEGTERETVMQETVMTRVGVDRVLRFAFELAQSRP 183 Query: 163 RKTLHIAHKANVLPLTQGLFLDTVKEVAKDFPLVNVQDIIVDNCAMQLVMRPERFDVIVT 222 +K L A K+N + +T + + V E+AK +P V V +D V+ P+ FDV+V Sbjct: 184 KKHLTSATKSNGISITMPYWDERVVEMAKGYPEVAVDKYHIDILTAHFVLHPDWFDVVVA 243 Query: 223 TNLLGDILSDLAAGLVGGLGLAPSGNIG---DTTAVFEPVHGSAPDIAGKGIANPTAAIL 279 +NL GDILSDL G +G+APSGNI D ++FEPVHGSAPDIAGKGIANP + Sbjct: 244 SNLFGDILSDLGPACTGTIGIAPSGNINPERDFPSLFEPVHGSAPDIAGKGIANPVGQVW 303 Query: 280 SAAMMLDYLGEKEAAKRVEKAVDLVL-ERGPRTPDLGGDATTEAFTEAVVEALKSL 334 + AMMLD+LG+ EAA + A++ VL + RT DLGG A T A +A+V AL+ L Sbjct: 304 AGAMMLDHLGQGEAAAAIVAALEEVLADPVRRTADLGGQAGTVACGDAIVAALERL 359 Lambda K H 0.319 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 359 Length adjustment: 29 Effective length of query: 305 Effective length of database: 330 Effective search space: 100650 Effective search space used: 100650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory