Align [LysW]-L-2-aminoadipate 6-kinase monomer (EC 2.7.2.17) (characterized)
to candidate 3606894 Dshi_0324 acetylglutamate kinase (RefSeq)
Query= metacyc::MONOMER-6801 (269 letters) >FitnessBrowser__Dino:3606894 Length = 287 Score = 115 bits (287), Expect = 1e-30 Identities = 88/276 (31%), Positives = 132/276 (47%), Gaps = 28/276 (10%) Query: 1 MIVVKVGGAEGINYEAVA---KDAASLWKEGVKLLLVHGGSAETNKVAEALGHPPRFLTH 57 ++V+K GG + EA+A +D + + GV ++VHGG N + L F+ Sbjct: 31 IVVIKFGGHAMGDAEAMASFARDIVLMRQVGVNPVIVHGGGPMINAMLAKLDINSDFVNG 90 Query: 58 PGGQVSRLTDRKTLEIFEMVYCGLVNKRLVELLQKEGANAIGLSGLDGRLFV-GRRKTAV 116 R+TD T+E+ EMV GLVNKR+V+ + +EG AIGLSG D L V A+ Sbjct: 91 -----KRVTDAATIEVVEMVLSGLVNKRIVQAINREGGRAIGLSGKDANLIVCDPADPAL 145 Query: 117 KYVENGKVKVHRGDYTGTVEEVNKALLDLLLQAGYLPVLTPPALSYENEAINTDGDQIAA 176 +V G EV L L+++ +PV+ P E E N +GD A Sbjct: 146 GFV-------------GEPVEVTPDTLLQLVRSEIIPVIAPIGTGREGETFNINGDTAAG 192 Query: 177 LLATLYGAEALVYLSNVPGLLARYPDEASLVREIPVERIEDPEYLALAQGRMKRKVMGAV 236 +A A+ L+ L++V G+ + +V E+ VE IE+ + G M K V Sbjct: 193 AIAAALKADRLLLLTDVSGV---KDAQGKVVTELTVENIEEMTAAGVIAGGMIPKTETCV 249 Query: 237 EAVKGGVKRVVFADGRVENPIRRAL---SGEGTVVR 269 A++GGV+ V DGR N L G G+++R Sbjct: 250 TAIRGGVRAAVILDGRAPNACLLELFTEHGAGSIIR 285 Lambda K H 0.317 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 287 Length adjustment: 25 Effective length of query: 244 Effective length of database: 262 Effective search space: 63928 Effective search space used: 63928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory