Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate 3607238 Dshi_0653 Prephenate dehydratase (RefSeq)
Query= BRENDA::Q9SA96 (392 letters) >FitnessBrowser__Dino:3607238 Length = 280 Score = 174 bits (441), Expect = 3e-48 Identities = 112/285 (39%), Positives = 147/285 (51%), Gaps = 15/285 (5%) Query: 106 VRISFQGIPGAYSETAALKAFPNCETVPCEQFEAAFQAVELWLVDKAVLPIENSVGGSIH 165 ++I+FQG PGAYS A A P+ E VPC FE F AV D +LP+ENS G + Sbjct: 3 LKIAFQGEPGAYSHQACHDARPDAEAVPCRTFEDVFAAVHDGSCDLGMLPVENSTYGRVA 62 Query: 166 RNYDLLLRHRLHIVQEVHLPVNHCLLGVPGVKKEDIKCVLSHPQALDQCVNSLNNLGIQR 225 + LL LHI++E + V+ LL VPG K DI+ SH L QC + L IQ Sbjct: 63 DIHRLLPESGLHIIEEAFVRVHINLLAVPGAKLGDIRTAQSHTVLLGQCRSFLRAHDIQP 122 Query: 226 ISAKDTATAAQTVSSSGKIDVGAIASVRAANIYGLDILAENIQDDVNNVTRFLILARE-P 284 ++ DTA +A V+ G A+AS A IYGLD+LA +I+D NN TRFLI+ E Sbjct: 123 VTGADTAGSAMHVAQEGNPAHAALASELAGEIYGLDVLARHIEDQDNNTTRFLIMTPELD 182 Query: 285 MIPRTDRPYKTSIVFSLEEGPGVLFKALAVFALRSINLSKIESRPQRRRPLRVVDGSNNG 344 + R TS VF + P L+KA+ FA +N++K+ES +V GS Sbjct: 183 LTRRGSGKMITSFVFQVRNIPAALYKAMGGFATNGVNMTKLES--------YMVGGSFTA 234 Query: 345 SAKYFDYLFYIDFEASMADTRAQHALGHLQEFASFIRILGCYPMD 389 + FY D E D + AL L F S + ILG YP D Sbjct: 235 TQ------FYADIEGHPDDANVRRALDELGYFTSQLEILGVYPAD 273 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 280 Length adjustment: 28 Effective length of query: 364 Effective length of database: 252 Effective search space: 91728 Effective search space used: 91728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory