Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate 3607238 Dshi_0653 Prephenate dehydratase (RefSeq)
Query= SwissProt::P27603 (365 letters) >FitnessBrowser__Dino:3607238 Length = 280 Score = 132 bits (333), Expect = 8e-36 Identities = 89/273 (32%), Positives = 142/273 (52%), Gaps = 10/273 (3%) Query: 95 LRVAYLGPEGTFSQAAALKHFGH-SVISKPMAAIDEVFREVVAGAVNFGVVPVENSTEGA 153 L++A+ G G +S A H + P ++VF V G+ + G++PVENST G Sbjct: 3 LKIAFQGEPGAYSHQAC--HDARPDAEAVPCRTFEDVFAAVHDGSCDLGMLPVENSTYGR 60 Query: 154 VNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDRITRIYSHAQSLAQCRKWLDAHYP 213 V E + I E +R+H +LL K I SH L QCR +L AH Sbjct: 61 VADIHRLLPESGLHIIEEAFVRVHINLLAVPGAKLGDIRTAQSHTVLLGQCRSFLRAH-- 118 Query: 214 NVERVAVSSNADAAKRVKSEWN--SAAIAGDMAAQLYGLSKLAEKIEDRPVNSTRFLIIG 271 +++ V + A +A V E N AA+A ++A ++YGL LA IED+ N+TRFLI+ Sbjct: 119 DIQPVTGADTAGSAMHVAQEGNPAHAALASELAGEIYGLDVLARHIEDQDNNTTRFLIMT 178 Query: 272 SQ-EVPPTGDDK--TSIIVSMRNKPGALHELLMPFHSNGIDLTRIETRPSRSGKWTYVFF 328 + ++ G K TS + +RN P AL++ + F +NG+++T++E+ F+ Sbjct: 179 PELDLTRRGSGKMITSFVFQVRNIPAALYKAMGGFATNGVNMTKLESYMVGGSFTATQFY 238 Query: 329 IDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYP 361 D GH D ++ L+++G+ L++LG YP Sbjct: 239 ADIEGHPDDANVRRALDELGYFTSQLEILGVYP 271 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 280 Length adjustment: 28 Effective length of query: 337 Effective length of database: 252 Effective search space: 84924 Effective search space used: 84924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory