Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate N515DRAFT_4363 N515DRAFT_4363 cystathionine gamma-synthase
Query= BRENDA::Q5H4T8 (397 letters) >FitnessBrowser__Dyella79:N515DRAFT_4363 Length = 399 Score = 341 bits (875), Expect = 2e-98 Identities = 182/378 (48%), Positives = 241/378 (63%), Gaps = 2/378 (0%) Query: 16 SLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEHQGFEYSRTHNPTRFAYERCVAA 75 S +T A+ G D GAV+PP++ ++ YA G + ++YSR+ NPTR +A Sbjct: 9 STSTCAVRAGIESDTQHGAVVPPLHLSTNYAFEGLGGKRAYDYSRSGNPTRDLLGNALAE 68 Query: 76 LEGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSFVD 135 LE G A ASGMAA + +EL+ AG V+A D YGGT+RL + ++ F D Sbjct: 69 LEQGAGAVVTASGMAAVALALELVPAGGRVLAAHDCYGGTWRLLDAWAKK-GRFTLEFAD 127 Query: 136 LTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQR 195 LTD A A + + +VW+ETP+NP+L++ D+ +A A G L VVDNTF SP LQ+ Sbjct: 128 LTDRVALAAGLASKPSLVWVETPSNPLLRITDVRHVAQAAHAAGALVVVDNTFLSPALQQ 187 Query: 196 PLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPFDSFLAL 255 PL LGAD+VVHS TKY+NGHSD+VGG V D A +A+Q+ + N G PFDSFL L Sbjct: 188 PLVLGADVVVHSTTKYINGHSDVVGGAVVARDQA-VADQLKWWGNCNGLTGAPFDSFLTL 246 Query: 256 RGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSGFGGIVSI 315 RGL+TL +R+R H ENA +A L+ H A+ KV YPGL SHP H LA RQ +GFG ++S Sbjct: 247 RGLRTLSVRLRQHQENAQRIATLLDGHAAVRKVYYPGLESHPGHALAARQQAGFGAMLSF 306 Query: 316 VLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVRL 375 L+G + F + + F+LAESLGGVESLV HPA MTHAS+ R GI+D+L+R+ Sbjct: 307 ELEGDVAQIEAFVNELKYFSLAESLGGVESLVAHPASMTHASMAPEARRTAGIADSLLRI 366 Query: 376 SVGIEDLGDLRGDLERAL 393 SVGIED DL D++ L Sbjct: 367 SVGIEDGDDLVRDVDAGL 384 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 399 Length adjustment: 31 Effective length of query: 366 Effective length of database: 368 Effective search space: 134688 Effective search space used: 134688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory