Align cysteine synthase (EC 2.5.1.47); O-ureido-L-serine synthase (EC 2.6.99.3) (characterized)
to candidate N515DRAFT_2767 N515DRAFT_2767 cysteine synthase A
Query= BRENDA::D2Z027 (324 letters) >FitnessBrowser__Dyella79:N515DRAFT_2767 Length = 313 Score = 432 bits (1112), Expect = e-126 Identities = 208/310 (67%), Positives = 262/310 (84%) Query: 3 LFNSILDTIGRTPIVRLQRMAPEHTSVYVKVESFNPGGSVKDRLALSVVLDAEAKGLLKP 62 +++SILDTIG+TP+V+L R+AP+H +YVKVE+FNP GSVKDRLAL+++LDAEA+G +KP Sbjct: 2 IYDSILDTIGKTPVVKLHRLAPKHVELYVKVEAFNPAGSVKDRLALAIILDAEARGTIKP 61 Query: 63 GDTIVECTSGNVGIALAMVAAARGYRFVAVMGDTYSVERRKLIRAYGGKLVLFPGHLGSK 122 G T+VE TSGN G+ALA V AARGY FVAVM +T+S+ERRKLIRAYGGK++L P Sbjct: 62 GQTVVEATSGNTGVALAAVCAARGYPFVAVMTETFSIERRKLIRAYGGKVLLTPAAERGS 121 Query: 123 GGNLIADELAEKYGWFRARQFDNPANPSYHRETTASEILADFAGKRLDHFVTGFGTTGTL 182 G A ELA+K+GWF ARQF+NPANP+YHR TTA+EIL DFAG+RLD+FVTG+GT GTL Sbjct: 122 GMVRKAKELADKHGWFLARQFENPANPAYHRSTTAAEILRDFAGRRLDYFVTGWGTGGTL 181 Query: 183 TGVGQMLRVARPEVRVVALEPSNAAMLARGEWSPHQIQGLAPNFVPGVLDRSVIDDLVTM 242 TGVG++L+VARPEV+V+A EP+ A++LA EW PH+IQG P+FVP VL+R V ++ + Sbjct: 182 TGVGEVLKVARPEVKVIASEPAGASLLAGKEWQPHKIQGWTPDFVPAVLNREVAQQILPV 241 Query: 243 DEVTARDTSRRLAAEEGIFAGISAGATVATALSIAEHAPEGTVLLAMLPDTGERYLSTFL 302 D+V ARDTSR LA +EGIF GIS+GAT+A AL +A+ APEG+VLLAMLPDTGERYLSTFL Sbjct: 242 DDVVARDTSRALAQKEGIFVGISSGATLAAALQVAKDAPEGSVLLAMLPDTGERYLSTFL 301 Query: 303 FDGVDEGSDD 312 F+GV+EGSD+ Sbjct: 302 FEGVNEGSDE 311 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 313 Length adjustment: 27 Effective length of query: 297 Effective length of database: 286 Effective search space: 84942 Effective search space used: 84942 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_2767 N515DRAFT_2767 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.17518.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-128 413.0 0.0 3.9e-128 412.8 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_2767 N515DRAFT_2767 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_2767 N515DRAFT_2767 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 412.8 0.0 3.9e-128 3.9e-128 2 298 .] 7 302 .. 6 302 .. 0.99 Alignments for each domain: == domain 1 score: 412.8 bits; conditional E-value: 3.9e-128 TIGR01139 2 seliGntPlvrLnlaeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGn 67 ++iG+tP+v+L++ +++++e++vk+e +nP++svkdr+ala+i dae +g++k+g+t+veatsGn lcl|FitnessBrowser__Dyella79:N515DRAFT_2767 7 LDTIGKTPVVKLHRLAPKHVELYVKVEAFNPAGSVKDRLALAIILDAEARGTIKPGQTVVEATSGN 72 579**********99999************************************************ PP TIGR01139 68 tGialamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnky 133 tG+ala v+aargy ++++m et+s+errkl++ayG +++Lt++ae+ +g+++ka+el+++++ + lcl|FitnessBrowser__Dyella79:N515DRAFT_2767 73 TGVALAAVCAARGYPFVAVMTETFSIERRKLIRAYGGKVLLTPAAERGSGMVRKAKELADKHG--W 136 ***************************************************************..9 PP TIGR01139 134 lllkqfenpanpeihrkttapeilkdldgk.ldafvagvGtGGtitGvgevlkekkpdikvvaveP 198 +l++qfenpanp++hr+tta+eil+d+ g+ ld fv+g+GtGGt+tGvgevlk ++p++kv+a+eP lcl|FitnessBrowser__Dyella79:N515DRAFT_2767 137 FLARQFENPANPAYHRSTTAAEILRDFAGRrLDYFVTGWGTGGTLTGVGEVLKVARPEVKVIASEP 202 9**************************9988*********************************** PP TIGR01139 199 aespvlsggkpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaa 264 a +++l+g++++phkiqG++++f+P+vL++ev ++++ v+d a +t+r la++eGi+vGissGa+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2767 203 AGASLLAGKEWQPHKIQGWTPDFVPAVLNREVAQQILPVDDVVARDTSRALAQKEGIFVGISSGAT 268 ****************************************************************** PP TIGR01139 265 vaaalkvakklekdkkivvilpdtgerYlstaLf 298 +aaal+vak++ ++ +++++lpdtgerYlst Lf lcl|FitnessBrowser__Dyella79:N515DRAFT_2767 269 LAAALQVAKDAPEGSVLLAMLPDTGERYLSTFLF 302 *******************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (313 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.22 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory