Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate N515DRAFT_2937 N515DRAFT_2937 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >FitnessBrowser__Dyella79:N515DRAFT_2937 Length = 435 Score = 364 bits (934), Expect = e-105 Identities = 200/429 (46%), Positives = 269/429 (62%), Gaps = 6/429 (1%) Query: 364 ASDKVGVQKALSRPIQ-KTSEIMHLVNPIIENVRDKGNSALLEYTEKFDGVKLSNPVLNA 422 A D +AL+RP Q + E+ V I+ VR +G++AL E + K+D + + Sbjct: 8 ALDPAAQLQALARPAQSRAEELRRGVEAIVAKVRAEGDTALRELSAKYDRCAIDAIEVTV 67 Query: 423 PFPEEYFEGLTEEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGL 482 L E+K A++ + + FH P + VET PGV R RPI KVGL Sbjct: 68 EEFAAAEAALAPELKAAIEEAAARIAAFHRESAP-RPVAVETAPGVRVERVLRPIAKVGL 126 Query: 483 YIPGGTAILPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLA 542 Y+P G+A LPSTALMLGVPA +A C+E+V SP R +DG+ V+Y A G ++ Sbjct: 127 YVPAGSAPLPSTALMLGVPAGLAGCREVVLCSPAR-ADGRCDEAVLYAARVTGVHRVFKL 185 Query: 543 GGAQAVAAMAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIA 602 GGAQA+AAMAYGT ++P+ DK+ GPGN +VT AK+ V D +IDMPAGPSEVLVIA Sbjct: 186 GGAQAIAAMAYGTGSVPRCDKLFGPGNAWVTEAKLQVSGDPDG-AAIDMPAGPSEVLVIA 244 Query: 603 DEDADVDFVASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVDIVRKC 662 D AD +FVA+DLLSQAEHG DSQVIL+ S+ + + V Q LPR I + Sbjct: 245 DGKADPEFVAADLLSQAEHGPDSQVILLSP--SDALLDRVAVEVERQCAALPRASIATQA 302 Query: 663 IAHSTIVLCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDY 722 +A S ++L D +A+ +SN+YAPEHLILQ+ + +D+AGS+F+GA+TPES GDY Sbjct: 303 LAQSRLILVDSLAQAVAVSNRYAPEHLILQVTEPRALLDGIDSAGSIFLGAWTPESVGDY 362 Query: 723 SSGTNHTLPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRN 782 SG+NH LPTYGYAR YSG + A+FQK IT Q ++ +GL IG +A+ E L+ HR Sbjct: 363 CSGSNHVLPTYGYARSYSGVSVASFQKQITVQELSADGLRAIGPCTATLAEAEQLEAHRR 422 Query: 783 AVKIRMSKL 791 AV +R++ L Sbjct: 423 AVTLRLAAL 431 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 712 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 435 Length adjustment: 37 Effective length of query: 762 Effective length of database: 398 Effective search space: 303276 Effective search space used: 303276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory