Align Histidine biosynthesis bifunctional protein HisB; EC 3.1.3.15; EC 4.2.1.19 (characterized)
to candidate N515DRAFT_2935 N515DRAFT_2935 imidazoleglycerol-phosphate dehydratase
Query= SwissProt::Q9S5G5 (355 letters) >lcl|FitnessBrowser__Dyella79:N515DRAFT_2935 N515DRAFT_2935 imidazoleglycerol-phosphate dehydratase Length = 354 Score = 387 bits (994), Expect = e-112 Identities = 196/355 (55%), Positives = 242/355 (68%), Gaps = 1/355 (0%) Query: 1 MSQKYLFIDRDGTLISEPPSDFQVDRFDKLAFEPGVIPQLLKLQKAGYKLVMITNQDGLG 60 MS+K LF+DRDG LI EP +D Q+D ++KLA PGVI L + AGY+LVM+TNQDGLG Sbjct: 1 MSRKLLFVDRDGCLIEEP-ADEQIDSYEKLALLPGVIAALQRCVAAGYELVMVTNQDGLG 59 Query: 61 TQSFPQADFDGPHNLMMQIFTSQGVQFDEVLICPHLPADECDCRKPKVKLVERYLAEQAM 120 T SFP+A F GPH L+M+I SQGV+F EVLI P D D RKP + ++ YLA+ Sbjct: 60 TDSFPEAHFTGPHELLMRILASQGVRFREVLIDRSFPRDGLDTRKPGIGMLRHYLADDGW 119 Query: 121 DRANSYVIGDRATDIQLAENMGINGLRYDRETLNWPMIGEQLTRRDRYAHVVRNTKETQI 180 RA S ++GDR TD+Q A NMG+ G + L W I QL R A V RNT+ET+I Sbjct: 120 SRAASAMVGDRQTDLQFAANMGVRGFLVGPKGLAWEEIAHQLLDAPRTATVTRNTRETRI 179 Query: 181 DVQVWLDREGGSKINTGVGFFDHMLDQIATHGGFRMEINVKGDLYIDDHHTVEDTGLALG 240 V+V LDR K TG+GFFDHML+QI HGGF +E+ GD ID+HHT+ED LALG Sbjct: 180 TVRVDLDRVAEPKAQTGLGFFDHMLEQIGKHGGFALELECDGDTRIDEHHTIEDCALALG 239 Query: 241 EALKIALGDKRGICRFGFVLPMDECLARCALDISGRPHLEYKAEFTYQRVGDLSTEMIEH 300 +AL+ ALGDKRGI R+GF LPMDE A ALD+SGRP+ ++ F +RVGD+ TE++ H Sbjct: 240 QALRQALGDKRGIARYGFTLPMDESQASAALDLSGRPYFVFEGSFPRERVGDVPTELVPH 299 Query: 301 FFRSLSYTMGVTLHLKTKGKNDHHRVESLFKAFGRTLRQAIRVEGDTLPSSKGVL 355 FFRSL T+G LHL G N HH VE+ FK R LRQA+R EG LPS+KG L Sbjct: 300 FFRSLCETLGANLHLSVYGDNAHHMVEACFKVVARALRQALRREGSELPSTKGAL 354 Lambda K H 0.322 0.140 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 354 Length adjustment: 29 Effective length of query: 326 Effective length of database: 325 Effective search space: 105950 Effective search space used: 105950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate N515DRAFT_2935 N515DRAFT_2935 (imidazoleglycerol-phosphate dehydratase)
to HMM TIGR01261 (hisB: histidinol-phosphatase (EC 3.1.3.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01261.hmm # target sequence database: /tmp/gapView.21427.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01261 [M=161] Accession: TIGR01261 Description: hisB_Nterm: histidinol-phosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-63 196.8 0.0 1.2e-62 196.3 0.0 1.2 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_2935 N515DRAFT_2935 imidazoleglycerol Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_2935 N515DRAFT_2935 imidazoleglycerol-phosphate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 196.3 0.0 1.2e-62 1.2e-62 2 160 .. 4 161 .. 3 162 .. 0.99 Alignments for each domain: == domain 1 score: 196.3 bits; conditional E-value: 1.2e-62 TIGR01261 2 kilfidrdGtlieePksdfqvdaleklklekkvipallklkeagyklvlvtnqdGlGtesfPkedf 67 k+lf+drdG lieeP d q+d++ekl+l ++vi+al + +agy+lv+vtnqdGlGt+sfP+++f lcl|FitnessBrowser__Dyella79:N515DRAFT_2935 4 KLLFVDRDGCLIEEPA-DEQIDSYEKLALLPGVIAALQRCVAAGYELVMVTNQDGLGTDSFPEAHF 68 89*************9.99*********************************************** PP TIGR01261 68 dkphalmlqifkseGivfddvlicphfledncacrkPkiklleeylkkekidkersyviGdretdl 133 +ph+l++ i+ s+G+ f++vli+++f+ d ++rkP i++l++yl+++ ++ s+++Gdr+tdl lcl|FitnessBrowser__Dyella79:N515DRAFT_2935 69 TGPHELLMRILASQGVRFREVLIDRSFPRDGLDTRKPGIGMLRHYLADDGWSRAASAMVGDRQTDL 134 ****************************************************************** PP TIGR01261 134 qlaenlgirglkykeeelnwkeiakel 160 q+a n+g+rg+ + l+w+eia++l lcl|FitnessBrowser__Dyella79:N515DRAFT_2935 135 QFAANMGVRGFLVGPKGLAWEEIAHQL 161 *************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (161 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.22 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory