GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvE in Dyella japonica UNC79MFTsu3.2

Align Branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate N515DRAFT_1217 N515DRAFT_1217 transcriptional regulator, GntR family

Query= reanno::azobra:AZOBR_RS06555
         (404 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_1217 N515DRAFT_1217
           transcriptional regulator, GntR family
          Length = 468

 Score =  182 bits (462), Expect = 2e-50
 Identities = 115/379 (30%), Positives = 193/379 (50%), Gaps = 15/379 (3%)

Query: 21  IRELLKLLERPEIISFAGGIPDPDFFPTAAIARAYEKIFQSNSGAGGALQYTISEGFTPL 80
           ++E+L +L R +++      P P   P AA+  A  +  + +  A   L Y   +G   L
Sbjct: 92  LQEVLDMLARSDVLPLHSATPSPALLPQAALTAALSRSLRHHPAA--VLDYAPPQGLPAL 149

Query: 81  REWICAYLGRRGIQAGLDEVLVTSGSQQALEFVGKLLIGPGEKILVTRPTYLGALQAFSP 140
           R  I     + G     DE+++T+G+ + +    + L  PG+ +LV  PTY G LQA + 
Sbjct: 150 RRQIARRYAQLGAAVSPDEIVITAGAMEGISLALRTLAEPGDVVLVETPTYHGILQAVAA 209

Query: 141 YEPQYLSVPG-DAEGPDLAAVEAALEQ-KPKFFYLVPDFQNPNGTTISLARREALLDLCA 198
              + L VP    +G D+A ++  L+Q + +   LVP+F NP G+    A ++ALL  CA
Sbjct: 210 LRLKVLEVPNLPGQGIDVARLDQLLQQNRVRAAVLVPNFNNPLGSVTGDAAKQALLASCA 269

Query: 199 KHGVPIVEDAAYTELRYEGE-PIPSMVALDAARNGGKITNVLFCGSFSKTMVPALRVGWI 257
           +HG  ++ED  Y +L + GE P P        R      N++ CGSFSK++ P LR+GWI
Sbjct: 270 RHGTVVIEDDVYGDLAWSGERPSP-------LRRWDTRGNLISCGSFSKSLSPGLRLGWI 322

Query: 258 NGPAEVINRLVLMKQAGDLHTSTINQIVLHDVVSQ-NFDSHIRRLRAGYKERRDAMLTAL 316
              A   + LV  K    +  +++ Q+ + + + + + + H+RRLR    +    +  A+
Sbjct: 323 AAGAWT-DALVRAKYFSTVGAASLPQLAMAEYLQKHDLERHLRRLRRALADNAQRLHEAI 381

Query: 317 SEFAPAGVTWTKPEGGMFVWIELPEGTDGVDLLARAIKDANVAFVPGSAFHADRSGKNTL 376
           S   PAG   ++P GG+ +W++LPEG DG  +L  A  +  +   PG  F +     + L
Sbjct: 382 SRHWPAGTRASEPRGGLSLWLQLPEGGDG-QMLFEAALEQGIGTSPGVLFSSRGDYGDCL 440

Query: 377 RLSFSNNNPERIREGIRRL 395
           RLS       R+ + +++L
Sbjct: 441 RLSCGMPWDARLEQALKKL 459


Lambda     K      H
   0.320    0.138    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 490
Number of extensions: 30
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 404
Length of database: 468
Length adjustment: 32
Effective length of query: 372
Effective length of database: 436
Effective search space:   162192
Effective search space used:   162192
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory