Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate N515DRAFT_1147 N515DRAFT_1147 4-hydroxy-tetrahydrodipicolinate synthase
Query= BRENDA::Q9I4W3 (292 letters) >FitnessBrowser__Dyella79:N515DRAFT_1147 Length = 297 Score = 248 bits (632), Expect = 2e-70 Identities = 132/272 (48%), Positives = 174/272 (63%) Query: 2 IAGSMVALVTPFDAQGRLDWDSLAKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVIR 61 I GS+ AL TPF + G LD D+ +L+D+ + GT A+V G+TGE+ L+ +E+ ++ Sbjct: 3 IGGSICALATPFTSDGALDLDAFGRLLDYQVAGGTQAVVVAGSTGEAHMLEHDEYETLLS 62 Query: 62 RVVDQVKGRIPVIAGTGANSTREAVALTEAAKSGGADACLLVTPYYNKPTQEGMYQHFRH 121 V ++ GRIPV+AGTG T VALT A+ GADA L+V P+Y +PTQEG+ +HF Sbjct: 63 FAVKRIAGRIPVLAGTGEAGTARTVALTRRARELGADAALVVAPFYVRPTQEGLRRHFLE 122 Query: 122 IAEAVAIPQILYNVPGRTSCDMLPETVERLSKVPNIIGIKEATGDLQRAKEVIERVGKDF 181 +AE +P +LYNVPGRT+CD+LPETV L + P I+GIKEA G +R + + E DF Sbjct: 123 VAEHGGLPVLLYNVPGRTACDLLPETVAALREHPAIVGIKEAVGSDERIRALAELARADF 182 Query: 182 LVYSGDDATAVELMLLGGKGNISVTANVAPRAMSDLCAAAMRGDAAAARAINDRLMPLHK 241 + SGDD TA + ML G G ISV AN+AP+A +LC AA GDAAA +D L PL + Sbjct: 183 VYLSGDDPTAGKAMLAGAAGTISVVANLAPKAFRELCDAATSGDAAATTRCDDVLAPLVQ 242 Query: 242 ALFIESNPIPVKWALHEMGLIPEGIRLPLTWL 273 AL NPI VK L +GL RLPL L Sbjct: 243 ALNCAPNPIAVKAGLPALGLGSAAPRLPLVEL 274 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 297 Length adjustment: 26 Effective length of query: 266 Effective length of database: 271 Effective search space: 72086 Effective search space used: 72086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_1147 N515DRAFT_1147 (4-hydroxy-tetrahydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.5738.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-88 281.7 0.0 2.6e-88 281.6 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_1147 N515DRAFT_1147 4-hydroxy-tetrahy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_1147 N515DRAFT_1147 4-hydroxy-tetrahydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 281.6 0.0 2.6e-88 2.6e-88 2 276 .. 6 279 .. 5 290 .. 0.97 Alignments for each domain: == domain 1 score: 281.6 bits; conditional E-value: 2.6e-88 TIGR00674 2 vltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknr 67 ++ Al TPf +dg +d++a+ +l+++q++ g++a+vv+G+TGE+ L ++E+++++++av+ ++r lcl|FitnessBrowser__Dyella79:N515DRAFT_1147 6 SICALATPFTSDGALDLDAFGRLLDYQVAGGTQAVVVAGSTGEAHMLEHDEYETLLSFAVKRIAGR 71 799*************************************************************** PP TIGR00674 68 vpviaGtgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvP 133 +pv+aGtg t+ ++ lt++a++lg+d++lvv+P+Y++PtqeGl +hf ++ae+ lP++lYnvP lcl|FitnessBrowser__Dyella79:N515DRAFT_1147 72 IPVLAGTGEAGTARTVALTRRARELGADAALVVAPFYVRPTQEGLRRHFLEVAEHGGLPVLLYNVP 137 ****************************************************************** PP TIGR00674 134 sRtgvslepetvkrLaeeveivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGv 199 +Rt+++l petv++L e++ iv+iKea g+ er+ + + a +df+ lsGdD ++ + ++ Ga+G lcl|FitnessBrowser__Dyella79:N515DRAFT_1147 138 GRTACDLLPETVAALREHPAIVGIKEAVGSDERIRALAELARADFVYLSGDDPTAGKAMLAGAAGT 203 ****************************************************************** PP TIGR00674 200 iSVasnvapkelkemvkaalegdteeareihqkllklfkalfietNPipvKtalallgliekdelR 265 iSV++n+apk ++e++ aa+ gd + + l +l++al++++NPi vK+ l +lgl + R lcl|FitnessBrowser__Dyella79:N515DRAFT_1147 204 ISVVANLAPKAFRELCDAATSGDAAATTRCDDVLAPLVQALNCAPNPIAVKAGLPALGLGSA-APR 268 ************************************************************99.*** PP TIGR00674 266 lPLtelseekk 276 lPL+el++ + lcl|FitnessBrowser__Dyella79:N515DRAFT_1147 269 LPLVELQDGPE 279 *****987643 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.03 # Mc/sec: 2.15 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory