Align Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 (characterized)
to candidate N515DRAFT_3307 N515DRAFT_3307 glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::P18335 (406 letters) >FitnessBrowser__Dyella79:N515DRAFT_3307 Length = 426 Score = 133 bits (335), Expect = 9e-36 Identities = 99/333 (29%), Positives = 151/333 (45%), Gaps = 25/333 (7%) Query: 26 FIPVKGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETLWHISNVFTNEP 85 F + G+ +WD +GK Y+D+ G +GH HP + A++ + E Sbjct: 33 FFTARADGAYLWDVEGKRYIDYVGSWGPMIVGHNHPRVREAVERAVKDGLSFGTPCPAEI 92 Query: 86 AL-RLGRKLIEATFAERVVFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGR 144 + +L+ + R+V NSGTEA +A +LAR + ++KI+ F +HG Sbjct: 93 TMAETITRLVPSVDMVRMV--NSGTEATMSAIRLARG------ATGRSKIVKFEGCYHGH 144 Query: 145 S-LFTVSVG------GQPKYSDGFGPKPADI-IHVPFNDLHAVKAVMDDH---TCAVVVE 193 F V G G P S G AD+ + + +NDL A +A+ +H +++E Sbjct: 145 GDSFLVKAGSGALTFGVPT-SPGVPKAAADLTLTLAYNDLAAAEALFAEHGADIAGLIIE 203 Query: 194 PIQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTS 253 P+ G +LQGLR LC +H ALL+FDEV G R A HYG+TPD+ T Sbjct: 204 PVAGNMNCIPPKDGYLQGLRALCTRHGALLIFDEVMTGF-RVALGGAQAHYGITPDLSTF 262 Query: 254 AKALGGGFPISAMLTTAEIASAFHPGS---HGSTYGGNPLACAVAGAAFDIINTPEVLEG 310 K +GGG P+ A E+ P T GNP+A A A ++I + Sbjct: 263 GKIIGGGMPVGAYGGRRELMEQIAPAGPIYQAGTLSGNPVAMAAGLAMLELIQEAGFYDR 322 Query: 311 IQAKRQRFVDHLQKIDQQYDVFSDIRGMGLLIG 343 + A+ + D LQ + V +G + G Sbjct: 323 LAARTRLLADGLQAVADGEGVPFSTNRVGAMFG 355 Lambda K H 0.322 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 426 Length adjustment: 31 Effective length of query: 375 Effective length of database: 395 Effective search space: 148125 Effective search space used: 148125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory