Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate N515DRAFT_2124 N515DRAFT_2124 diaminopimelate decarboxylase
Query= reanno::Korea:Ga0059261_2051 (419 letters) >FitnessBrowser__Dyella79:N515DRAFT_2124 Length = 426 Score = 339 bits (869), Expect = 1e-97 Identities = 182/401 (45%), Positives = 252/401 (62%), Gaps = 2/401 (0%) Query: 14 ENVSIPAIAAEVGTPVYVYSTATLERHASALKNALAGLPSVHLAFAIKANPNLAVLGVLA 73 + V + +A + TP + YS + + L+ AL G ++ L +A+KAN NLA+L ++A Sbjct: 19 DGVDLRRLAERIPTPFHAYSANAIRTRIAGLQQALHGFDAL-LCYAVKANSNLAILQLMA 77 Query: 74 RQGYGADVVSGGELKRALAAGMPAEDVVFSGVGKTRAELQLGLDEGIGQFNLELEEEGEV 133 G GAD+VS GEL RAL AG+PA+ +VFSGVGKT AE+ L GI +FN+E +E E+ Sbjct: 78 EAGVGADIVSSGELWRALHAGIPAQRIVFSGVGKTAAEIAEALAAGILRFNVESADELEL 137 Query: 134 LADLAHAQGKTAPAVLRVNPDVDAGTHAKISTGKAENKFGVAIDRALEIFDRLAKRPGLN 193 L +A A A +R+NPDVDA THAKISTGKAENKFGV+ID A F A++ + Sbjct: 138 LQRMAAELHVVAHAAVRINPDVDAQTHAKISTGKAENKFGVSIDEARRWFADSARQANVR 197 Query: 194 LRGVAIHIGSQLTELAPLEAAYKRVGELVAQLRAAGHTITHVDLGGGLGVPYHAGQTVST 253 L G+ +HIGSQ+ + P A+ RV +L AAGH I +D+GGGLGV Y GQ Sbjct: 198 LDGLHVHIGSQILSVEPFRLAFARVAAFWRELEAAGHAIASIDVGGGLGVRYRDGQVPIP 257 Query: 254 AEEFGAMVARVTQGWNVTLMFEPGRFICGNAGVLVTEVIWVKPAAGNPYVIVDAAMNDLA 313 ++ A + G+ L+ EPGR++ AGVL+T V+ VK ++++DAAMNDL Sbjct: 258 PGDYAAAIREALAGFRGRLLLEPGRYLVAEAGVLLTRVVRVKHGERRRFLVLDAAMNDLL 317 Query: 314 RPALYDAYHEF-EAVEPTGEKFVANIAGPVCETGDTFAMGREIDVVKSGDLAVFRTAGAY 372 RP+LYDA+H+ ++ ++ GPVCETGDTFA+ RE+ + +G+L + RT GAY Sbjct: 318 RPSLYDAWHDIVPLLDDARPPHRYDVVGPVCETGDTFAVERELPELHAGELVLIRTTGAY 377 Query: 373 GATMASTYNSRALVPEVLVSGDRFAVVADRIQPETIMGAER 413 GA MASTYNSR L EVL+ R A+V R E ++ E+ Sbjct: 378 GAAMASTYNSRPLAAEVLLDRGRHAIVRRRQSLEDMVAGEQ 418 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 525 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 426 Length adjustment: 32 Effective length of query: 387 Effective length of database: 394 Effective search space: 152478 Effective search space used: 152478 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate N515DRAFT_2124 N515DRAFT_2124 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.18869.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-146 472.7 0.0 4.9e-146 472.4 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_2124 N515DRAFT_2124 diaminopimelate d Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_2124 N515DRAFT_2124 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 472.4 0.0 4.9e-146 4.9e-146 11 416 .. 18 417 .. 11 418 .. 0.98 Alignments for each domain: == domain 1 score: 472.4 bits; conditional E-value: 4.9e-146 TIGR01048 11 iegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgl 76 +gvdl++lae+ tP++ y+++++r r++ l++a ++ ++l++YAvKAnsnla+l+l+ae+G+g+ lcl|FitnessBrowser__Dyella79:N515DRAFT_2124 18 FDGVDLRRLAERIPTPFHAYSANAIRTRIAGLQQALHGFDALLCYAVKANSNLAILQLMAEAGVGA 83 6899**********************************999************************* PP TIGR01048 77 dvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkka 142 d+vs GEl ral+Ag++a++ivfsg+gk+ +e+++al+++i +nv+s +elell+++a+el a lcl|FitnessBrowser__Dyella79:N515DRAFT_2124 84 DIVSSGELWRALHAGIPAQRIVFSGVGKTAAEIAEALAAGILRFNVESADELELLQRMAAELHVVA 149 ****************************************************************** PP TIGR01048 143 rvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepf 208 + ++R+npdvda+th +isTG++e+KFG++++ea++ + +++++++l G+hvHIGSqil +epf lcl|FitnessBrowser__Dyella79:N515DRAFT_2124 150 HAAVRINPDVDAQTHAKISTGKAENKFGVSIDEARRWFADSARQANVRLDGLHVHIGSQILSVEPF 215 ****************************************************************** PP TIGR01048 209 veaaekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelglklkl 274 + a+++v+ + +el+++g ++ +d+GGGlg++y++ + ++ + +ya+++ e+l++ ++ +l lcl|FitnessBrowser__Dyella79:N515DRAFT_2124 216 RLAFARVAAFWRELEAAGHAIASIDVGGGLGVRYRDGQVPIPPGDYAAAIREALAG-----FRGRL 276 ***************************************************99999.....89*** PP TIGR01048 275 ilEpGRslvanagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkrleeeetetv 340 +lEpGR+lva+agvlltrV vK+ e r+f + Da+mndl+Rp+lY+a+h+i++l + ++++ +++ lcl|FitnessBrowser__Dyella79:N515DRAFT_2124 277 LLEPGRYLVAEAGVLLTRVVRVKHGERRRFLVLDAAMNDLLRPSLYDAWHDIVPLLD-DARPPHRY 341 *******************************************************55.8999**** PP TIGR01048 341 dvvGplCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrr 406 dvvGp+CE+gD++a +relpe ++G+l++++ +GAYga+m+s+Ynsrp +aevl++ g+ ++rrr lcl|FitnessBrowser__Dyella79:N515DRAFT_2124 342 DVVGPVCETGDTFAVERELPELHAGELVLIRTTGAYGAAMASTYNSRPLAAEVLLDRGRHAIVRRR 407 ****************************************************************** PP TIGR01048 407 etledllale 416 ++led++a e lcl|FitnessBrowser__Dyella79:N515DRAFT_2124 408 QSLEDMVAGE 417 ******9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (426 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.38 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory