GapMind for Amino acid biosynthesis

 

Aligments for a candidate for metB in Dyella japonica UNC79MFTsu3.2

Align cystathionine gamma-synthase (EC 2.5.1.48) (characterized)
to candidate N515DRAFT_4305 N515DRAFT_4305 cystathionine gamma-lyase

Query= BRENDA::Q1M0P5
         (380 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_4305 N515DRAFT_4305
           cystathionine gamma-lyase
          Length = 392

 Score =  400 bits (1029), Expect = e-116
 Identities = 201/373 (53%), Positives = 261/373 (69%), Gaps = 2/373 (0%)

Query: 5   TKLIHGGISEDATTGAVSVPIYQTSTYRQDAIGHHKGYEYSRSGNPTRFALEELIADLEG 64
           T  IH G S D TTGA+  PIY TSTY Q++ G HKGYEYSR+ NPTR A E  +A LEG
Sbjct: 18  TLAIHAGQSPDPTTGAIMTPIYATSTYVQESPGKHKGYEYSRTQNPTRMAYEACVAALEG 77

Query: 65  GVKGFAFASGLAGIHAVFSLLQSGDHVLLGDDVYGGTFRLFNKVLVKN-GLSCTIIDTSD 123
           GV GFAF SGLA    V  LL SG HV+  DD+YGG++RLF +V  ++ GL  T +D +D
Sbjct: 78  GVAGFAFGSGLAAAATVLDLLDSGSHVIAMDDLYGGSYRLFERVRRRSAGLDFTFVDLND 137

Query: 124 LSQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFATPYYQNPLL 183
              +K A+KPNTK ++ ETP+NP+LK+ DLA+ A+ AK HGL+ +VDNTF +P  Q P  
Sbjct: 138 AQALKAALKPNTKMIWAETPTNPMLKLVDLAKVAAFAKKHGLILVVDNTFCSPMIQRPFE 197

Query: 184 LGADIVVHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLGPQDSWLLQRGIK 243
            GAD+V+HS TKYL GHSD+V G+V    + LA+ + F QN++G V GP DS+L  RG+K
Sbjct: 198 SGADLVLHSATKYLNGHSDMVGGIVVAREQELAERMGFLQNSVGAVAGPFDSFLAMRGLK 257

Query: 244 TLGLRMQAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRGFSGMLSFTLKN 303
           TL LRM+AH ++AL +A++LEKHP+VERV YPGL +HP + LA++QM GF G++S  +K 
Sbjct: 258 TLHLRMKAHCESALELAQWLEKHPEVERVIYPGLKSHPQHALARRQMHGFGGIISIEVKG 317

Query: 304 D-SEATPFVESLKLFILGESLGGVESLVGVPAFMTHACIPKTQREAAGIRDGLVRLSVGI 362
              +A   +E   LF L ESLGGVESL+  PA MTHA +P   R+  GI D L+RLSVG+
Sbjct: 318 GLRKARRMLERCHLFALAESLGGVESLIEHPAIMTHASVPPANRKRLGISDSLIRLSVGV 377

Query: 363 EHEQDLLEDLEQA 375
           E   DL  +L +A
Sbjct: 378 EDIADLRSELAEA 390


Lambda     K      H
   0.318    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 453
Number of extensions: 16
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 380
Length of database: 392
Length adjustment: 30
Effective length of query: 350
Effective length of database: 362
Effective search space:   126700
Effective search space used:   126700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory