Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate N515DRAFT_1431 N515DRAFT_1431 chorismate mutase
Query= SwissProt::P27603 (365 letters) >FitnessBrowser__Dyella79:N515DRAFT_1431 Length = 362 Score = 375 bits (963), Expect = e-108 Identities = 188/358 (52%), Positives = 259/358 (72%), Gaps = 4/358 (1%) Query: 7 LKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHIME 66 L+ +R RIDS+D +I +LISERA AQEVARVK A + +YRPEREA VL+ +++ Sbjct: 8 LEQVRERIDSIDRQIQELISERAGWAQEVARVKGAGLSAID---YYRPEREAHVLRMVVD 64 Query: 67 LNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMAA 126 N+GPL + EM RLFREIMSSCLA E PL+V +LGPEGTFS+ A KHFGH+ P+ + Sbjct: 65 RNRGPLSDTEMVRLFREIMSSCLAQEDPLKVGFLGPEGTFSEQAVRKHFGHAAYGLPLGS 124 Query: 127 IDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETT 186 I+EVF+EV AG +FGVVPVENS +G + TLD FL + ICGE+ELR+H L + Sbjct: 125 IEEVFQEVAAGHADFGVVPVENSGQGMIQITLDMFLTSEATICGEIELRVHQ-CLHSQGG 183 Query: 187 KTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQ 246 + + I R+Y+HAQSL QC+ WL + P+VE +AVSSNA+AA+ + ++AAIAG+ A + Sbjct: 184 RMEDIKRVYAHAQSLQQCKTWLRINLPDVECIAVSSNAEAARMARHADDAAAIAGETAGR 243 Query: 247 LYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFHSN 306 +YGL LA IEDR N+TRFL+IG PP+G+D+TS+++++ +KPGAL+++L PF + Sbjct: 244 VYGLKTLATGIEDRADNTTRFLVIGRSLFPPSGNDRTSLLITVNDKPGALYDVLSPFAKH 303 Query: 307 GIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKAV 364 + L RIE+RP+ +GKW Y FFID GH QD I+ ++++G A ++VLGSYP A+ Sbjct: 304 DVSLNRIESRPAHTGKWQYAFFIDVSGHVQDAPIQAAMQEMGGAAAQVRVLGSYPVAL 361 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 362 Length adjustment: 29 Effective length of query: 336 Effective length of database: 333 Effective search space: 111888 Effective search space used: 111888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory