GapMind for Amino acid biosynthesis

 

Aligments for a candidate for pre-dehydr in Dyella japonica UNC79MFTsu3.2

Align prephenate dehydrogenase (EC 1.3.1.12); prephenate dehydratase (EC 4.2.1.51); Chorismate mutase (EC 5.4.99.5) (characterized)
to candidate N515DRAFT_1431 N515DRAFT_1431 chorismate mutase

Query= BRENDA::O30012
         (620 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_1431 N515DRAFT_1431
           chorismate mutase
          Length = 362

 Score =  172 bits (435), Expect = 3e-47
 Identities = 119/342 (34%), Positives = 181/342 (52%), Gaps = 18/342 (5%)

Query: 260 TKKAESIEELRGLIKSIDSLILRLIERRIDAARQIARIKMERGEPIELKDVEEE----KL 315
           T+   S+E++R  I SID  I  LI  R   A+++AR+K      I+    E E    ++
Sbjct: 2   TEPKASLEQVRERIDSIDRQIQELISERAGWAQEVARVKGAGLSAIDYYRPEREAHVLRM 61

Query: 316 WEVMSKTTLNPVKLKEIFEGIMS--LAKEEEYKVAGVKYTIAVLGPQGSFSEEMALKLVG 373
               ++  L+  ++  +F  IMS  LA+E+  KV         LGP+G+FSE+   K  G
Sbjct: 62  VVDRNRGPLSDTEMVRLFREIMSSCLAQEDPLKVG-------FLGPEGTFSEQAVRKHFG 114

Query: 374 SRVPLRYCSTTDEIIKLVESGEVDYGLVPIENSVNGTVLPVIDALLNHDVEVFGEAKLEV 433
                    + +E+ + V +G  D+G+VP+ENS  G +   +D  L  +  + GE +L V
Sbjct: 115 HAAYGLPLGSIEEVFQEVAAGHADFGVVPVENSGQGMIQITLDMFLTSEATICGEIELRV 174

Query: 434 NHCLVAKRKIELKEIKTIYSHPQAVAQCMGFINNYLPSVAIRYTTSTSDAARML--DDYS 491
           + CL ++    +++IK +Y+H Q++ QC  ++   LP V     +S ++AARM    D +
Sbjct: 175 HQCLHSQGG-RMEDIKRVYAHAQSLQQCKTWLRINLPDVECIAVSSNAEAARMARHADDA 233

Query: 492 AAIMSENAARFYRLHVLRKGIQDLKGRNITRFYLIRRRSGRSEGK-ITSLFFGVEDKPGA 550
           AAI  E A R Y L  L  GI+D +  N TRF +I R      G   TSL   V DKPGA
Sbjct: 234 AAIAGETAGRVYGLKTLATGIED-RADNTTRFLVIGRSLFPPSGNDRTSLLITVNDKPGA 292

Query: 551 LKDVLEVFHKKGFNLRKLESRPAGTGLGDYVFFVEVEAPLRE 592
           L DVL  F K   +L ++ESRPA TG   Y FF++V   +++
Sbjct: 293 LYDVLSPFAKHDVSLNRIESRPAHTGKWQYAFFIDVSGHVQD 334


Lambda     K      H
   0.320    0.137    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 408
Number of extensions: 14
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 620
Length of database: 362
Length adjustment: 33
Effective length of query: 587
Effective length of database: 329
Effective search space:   193123
Effective search space used:   193123
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory