GapMind for Amino acid biosynthesis

 

Aligments for a candidate for tyrB in Dyella japonica UNC79MFTsu3.2

Align Probable aspartate aminotransferase; AspAT; EC 2.6.1.1; Transaminase A (uncharacterized)
to candidate N515DRAFT_2186 N515DRAFT_2186 alanine-synthesizing transaminase

Query= curated2:P63499
         (429 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_2186 N515DRAFT_2186
           alanine-synthesizing transaminase
          Length = 410

 Score =  320 bits (819), Expect = 7e-92
 Identities = 173/394 (43%), Positives = 239/394 (60%), Gaps = 1/394 (0%)

Query: 31  SAKLQDVLYEIRGPVHQHAARLEAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQ 90
           SA L +V YEIRG + + +  LEA G  I+KLNIGNP  +GFE P  +   I   L  ++
Sbjct: 5   SAHLAEVRYEIRGALTRRSRELEAAGLPIIKLNIGNPGRYGFETPPHLRDAIAAHLRDSE 64

Query: 91  GYSDSQGILSARRAVVTRYELVPGFPRFDVDDVYLGNGVSELITMTLQALLDNGDQVLIP 150
            Y   QG+  AR  +  + +   G    +V+ +++GNGVSELI ++L+ALL  GD+VL+P
Sbjct: 65  AYGHEQGLEEARETIAAQ-QRARGARGVEVERIFVGNGVSELIDLSLRALLQPGDEVLLP 123

Query: 151 SPDYPLWTASTSLAGGTPVHYLCDETQGWQPDIADLESKITERTKALVVINPNNPTGAVY 210
           SPDYPLW+A+T L  G P +Y C    G  PD  ++E+ +T RT+A+V+INPNNPTGAVY
Sbjct: 124 SPDYPLWSAATILNDGQPRYYRCLAENGHLPDPDEIEALVTARTRAIVLINPNNPTGAVY 183

Query: 211 SCEILTQMVDLARKHQLLLLADEIYDKILYDDAKHISLASIAPDMLCLTFNGLSKAYRVA 270
             E+L ++V +A +H LLLL DEIYD+ILYD A+ + LA++A D+ C++F GLSK +R  
Sbjct: 184 PRELLERIVRIAERHHLLLLTDEIYDEILYDGAQFVPLATVAGDVPCVSFGGLSKVHRAC 243

Query: 271 GYRAGWLAITGPKEHASSFIEGIGLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGR 330
           GYR GW++++G       + + + LLA +RLC NV AQ A++ AL    +I  L  PGGR
Sbjct: 244 GYRVGWMSLSGDPVRTHDYRDALQLLAALRLCANVTAQWAVRPALESKPTIGALTSPGGR 303

Query: 331 LLEQRDIAWTKLNEIPGVSCVKPAGALYAFPRLDPEVYDIDDDEQLVLDLLLSEKILVTQ 390
           L E R +    +     +    P GALYAFPR+  +     DD    L LL  E +LV  
Sbjct: 304 LHEARRMILEGVANSEFLDLATPGGALYAFPRVRADRVPRFDDNAFALRLLEEESVLVVP 363

Query: 391 GTGFNWPAPDHLRLVTLPWSRDLAAAIERLGNFL 424
           G+ FN P   HLRL  LP    L     R+   L
Sbjct: 364 GSSFNVPDSRHLRLTLLPPPEQLREVFVRIERVL 397


Lambda     K      H
   0.320    0.138    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 527
Number of extensions: 29
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 429
Length of database: 410
Length adjustment: 32
Effective length of query: 397
Effective length of database: 378
Effective search space:   150066
Effective search space used:   150066
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory