Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate HSERO_RS17320 HSERO_RS17320 amino acid acetyltransferase
Query= BRENDA::P22567 (432 letters) >FitnessBrowser__HerbieS:HSERO_RS17320 Length = 440 Score = 410 bits (1055), Expect = e-119 Identities = 218/431 (50%), Positives = 280/431 (64%), Gaps = 1/431 (0%) Query: 3 DYVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRP 62 ++VNWLR +PY+++ R +TFVV PGE V + + DL LLH+LG R+V+VHGSRP Sbjct: 9 EFVNWLRSVAPYVHAFRGKTFVVAFPGELVTAGDLQVLAQDLSLLHALGIRVVVVHGSRP 68 Query: 63 QIEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLR 122 Q+ +LA R + R+H LRV D+ LEC +A G LR+ IEA S + +PM + +R Sbjct: 69 QVAEQLALRNVEARFHNGLRVADSAALECAKEAAGELRLDIEAAFSQGLPNTPMAHSAIR 128 Query: 123 VAGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNL 182 V GN VTARP+GV++GVD TG VR+I I +++ IVLLSPLG+SPTGE FNL Sbjct: 129 VISGNFVTARPMGVIDGVDLQLTGVVRKIAADVIQPIMNAGGIVLLSPLGFSPTGEAFNL 188 Query: 183 ACEDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRPQQVPAHLQRLGNSYQAEL-L 241 EDVA+ AAI L AEKLI + DA G +REL Q A L S +A L Sbjct: 189 TMEDVAVSAAIALRAEKLIFLSETPMMTDAGGAEIRELSSHQAEAVLSAGFLSPEAAFYL 248 Query: 242 DAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLIE 301 + +AC AGV R+HIV + DG+ L ELFT G GT+V E E LR+A IEDVGG+++ Sbjct: 249 ASVVKACNAGVSRAHIVPFATDGSALLELFTHDGVGTMVTYENLESLRQATIEDVGGILK 308 Query: 302 LIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACLAVNPE 361 LI PLE G LV+R RE++EREI FS++E + +I CAALYP GE+ACL VNPE Sbjct: 309 LIEPLEADGTLVKRGRELIEREIHYFSVIEHDNVIFGCAALYPFPKERMGEMACLTVNPE 368 Query: 362 YRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARASLYNF 421 + G GD +L+ IE RAR GL LFVLTTRT+HWF +RGF + V LP R +YN+ Sbjct: 369 VQGQGDGDRILKHIETRAREAGLTKLFVLTTRTSHWFLKRGFVLAGVNDLPQDRQQIYNW 428 Query: 422 QRNSQVFEKSL 432 QR SQV K+L Sbjct: 429 QRKSQVLIKNL 439 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 471 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 440 Length adjustment: 32 Effective length of query: 400 Effective length of database: 408 Effective search space: 163200 Effective search space used: 163200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate HSERO_RS17320 HSERO_RS17320 (amino acid acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.14972.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-190 618.7 0.1 3.2e-190 618.5 0.1 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS17320 HSERO_RS17320 amino acid acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS17320 HSERO_RS17320 amino acid acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 618.5 0.1 3.2e-190 3.2e-190 1 429 [] 10 439 .. 10 439 .. 0.98 Alignments for each domain: == domain 1 score: 618.5 bits; conditional E-value: 3.2e-190 TIGR01890 1 fvkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakr 68 fv+wlr++aPy++a+r+kt+vv+++gelv ++ l+ l++d++llh+lG+r+v+vhG+rpq+ e+la r lcl|FitnessBrowser__HerbieS:HSERO_RS17320 10 FVNWLRSVAPYVHAFRGKTFVVAFPGELVTAGDLQVLAQDLSLLHALGIRVVVVHGSRPQVAEQLALR 77 8******************************************************************* PP TIGR01890 69 grtthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveG 136 ++++++++Glrv+d a+le++keaaGelrl+iea++s+ l+ntpma s ++v+sGnfvtarP+Gv++G lcl|FitnessBrowser__HerbieS:HSERO_RS17320 78 NVEARFHNGLRVADSAALECAKEAAGELRLDIEAAFSQGLPNTPMAHSAIRVISGNFVTARPMGVIDG 145 ******************************************************************** PP TIGR01890 137 vdyehtGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteed 204 vd++ tG+vrki a+ i+ ++++ ivllsPlgfs+tGe+fnl+medva s+ai+l+a+kli+l+e++ lcl|FitnessBrowser__HerbieS:HSERO_RS17320 146 VDLQLTGVVRKIAADVIQPIMNAGGIVLLSPLGFSPTGEAFNLTMEDVAVSAAIALRAEKLIFLSETP 213 ******************************************************************** PP TIGR01890 205 GildadGklvaelsaqeveslver.leeettarllsaavkalrgGvarshlvsyaedGallqelftrd 271 + da G ++els++++e+++ + a +l ++vka+++Gv+r+h+v++a+dG+ l+elft+d lcl|FitnessBrowser__HerbieS:HSERO_RS17320 214 MMTDAGGAEIRELSSHQAEAVLSAgFLSPEAAFYLASVVKACNAGVSRAHIVPFATDGSALLELFTHD 281 ***************999998865333444599*********************************** PP TIGR01890 272 GiGtlvskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaal 339 G+Gt+v+ e+les+r+ati+dvggil+li+Ple++G+lv+r rel+erei+ fsvie+d +i+gcaal lcl|FitnessBrowser__HerbieS:HSERO_RS17320 282 GVGTMVTYENLESLRQATIEDVGGILKLIEPLEADGTLVKRGRELIEREIHYFSVIEHDNVIFGCAAL 349 ******************************************************************** PP TIGR01890 340 ypyaeeevgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvde 407 yp+++e++ge+acl+v+Pe+++ g+G+r+lkhie+rar+ Gl +lfvlttrt+hWf++rGf+ a+v++ lcl|FitnessBrowser__HerbieS:HSERO_RS17320 350 YPFPKERMGEMACLTVNPEVQGQGDGDRILKHIETRAREAGLTKLFVLTTRTSHWFLKRGFVLAGVND 417 ******************************************************************** PP TIGR01890 408 lPearrklynyqrrskilvkkl 429 lP++r++ yn+qr+s++l+k+l lcl|FitnessBrowser__HerbieS:HSERO_RS17320 418 LPQDRQQIYNWQRKSQVLIKNL 439 *******************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (440 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.27 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory