Align Argininosuccinate lyase; ASAL; ASL; Arginosuccinase; EC 4.3.2.1 (characterized)
to candidate HSERO_RS14685 HSERO_RS14685 argininosuccinate lyase
Query= SwissProt::Q9LAE5 (461 letters) >FitnessBrowser__HerbieS:HSERO_RS14685 Length = 464 Score = 442 bits (1137), Expect = e-128 Identities = 224/458 (48%), Positives = 305/458 (66%), Gaps = 1/458 (0%) Query: 3 KEQTWSQRFESALHPAIARFNASIGFDIELIEYDLTGSQAHAKMLAHTGIISSEEGEQLV 62 K + WS RF + + R+ AS+ FD + + D+ GS AHA+MLAH GIIS+ + ++ Sbjct: 8 KGEAWSARFSEPVSDLVKRYTASVFFDNRMAQVDIQGSLAHAEMLAHQGIISAADYAEIQ 67 Query: 63 AGLEQIRQEHRQGKFHPGVDAEDVHFAVEKRLTEIVGDVGKKLHTARSRNDQVGTDTRLY 122 G+ QI+ E G+F +D EDVH +EKRLTE+VGD GK+LHT RSRNDQV TD RLY Sbjct: 68 RGMAQIKGEIEAGQFEWLLDLEDVHLNIEKRLTELVGDAGKRLHTGRSRNDQVATDIRLY 127 Query: 123 LRDQIQQIKSELREFQGVLLDIAEKHVETLIPGYTHLQRAQPVSLAHHLLAYFQMAQRDW 182 +R + I LRE + LLD+AE+H +T++PG+TH+Q AQP++ HH+LAY +M RD Sbjct: 128 MRGAVDDIIGLLRELRLALLDLAEQHADTILPGFTHMQVAQPITFGHHVLAYVEMFGRDA 187 Query: 183 ERLGDVSRRVNISPLGCGALAGTTFPIDRHYTAKLLDFDNIYANSLDGVSDRDFAIEFLC 242 ER+ D +R+N PLG ALAGTTFPIDR AK L FD++ NSLD VSDRDFAIEF Sbjct: 188 ERMIDARKRINRLPLGAAALAGTTFPIDRLRVAKTLGFDDVCRNSLDAVSDRDFAIEFCA 247 Query: 243 AASLIMVHLSRLAEEVILWSSEEFRFVILKDSCATGSSIMPQKKNPDVPELVRGKTGRVF 302 A+L+M H+SR++EE+++W S F+ + D TGSSIMPQKKNPDVPEL RGKTGRV Sbjct: 248 GAALVMTHISRMSEELVIWMSPRVGFIDIADRFCTGSSIMPQKKNPDVPELARGKTGRVN 307 Query: 303 GHLQAMLVIMKGLPLAYNKDLQEDKEGLFDSVNTVKASLEAMTILLREGLEFRTQRLAQA 362 GHL A+L +MKG PLAYNKD QEDKE LFD+V+T+ +L + R G+ + + + A Sbjct: 308 GHLIALLTLMKGQPLAYNKDNQEDKEPLFDTVDTLTDTLRIFADMAR-GISVKPEAMRAA 366 Query: 363 VTEDFSNATDVADYLAARGVPFREAYNLVGKVVKTSIAAGKLLKDLELEEWQQLHPAFAA 422 + ++ ATD+ADYL +G+PFR+A+ V V+T + G L DL L + + Sbjct: 367 ALQGYATATDLADYLVKKGLPFRDAHEAVAHAVRTCVDKGCDLADLSLADLRAFSDLIGE 426 Query: 423 DIYEAISPRQVVAARNSHGGTGFVQVSKALIAARAQID 460 D++ ++ VAAR+ GGT QV A+ R +++ Sbjct: 427 DVFAVLTLEGSVAARDHIGGTAPKQVRAAIAQLRKELN 464 Lambda K H 0.320 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 516 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 464 Length adjustment: 33 Effective length of query: 428 Effective length of database: 431 Effective search space: 184468 Effective search space used: 184468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate HSERO_RS14685 HSERO_RS14685 (argininosuccinate lyase)
to HMM TIGR00838 (argH: argininosuccinate lyase (EC 4.3.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00838.hmm # target sequence database: /tmp/gapView.22641.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00838 [M=455] Accession: TIGR00838 Description: argH: argininosuccinate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-189 616.4 0.0 2.1e-189 616.2 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS14685 HSERO_RS14685 argininosuccinate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS14685 HSERO_RS14685 argininosuccinate lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 616.2 0.0 2.1e-189 2.1e-189 2 454 .. 12 463 .. 11 464 .] 1.00 Alignments for each domain: == domain 1 score: 616.2 bits; conditional E-value: 2.1e-189 TIGR00838 2 wggRlkkeldkavaefnaslsfDkelaeaDiegsiahtkaLakagilteeeakklieaLeelkeevke 69 w+ R+++ +++ v++++as+ fD+++a+ Di+gs+ah+++La++gi+++ + ++++++++++k e+++ lcl|FitnessBrowser__HerbieS:HSERO_RS14685 12 WSARFSEPVSDLVKRYTASVFFDNRMAQVDIQGSLAHAEMLAHQGIISAADYAEIQRGMAQIKGEIEA 79 9******************************************************************* PP TIGR00838 70 gklelevdaeDiHlavErelidkvgedvgkklhtgrsRnDqvatdlrlylrdkvkelaealkdllkal 137 g++e+ d eD+Hl++E++l++ vg d+gk+lhtgrsRnDqvatd+rly+r +v++++ l++l+ al lcl|FitnessBrowser__HerbieS:HSERO_RS14685 80 GQFEWLLDLEDVHLNIEKRLTELVG-DAGKRLHTGRSRNDQVATDIRLYMRGAVDDIIGLLRELRLAL 146 *************************.****************************************** PP TIGR00838 138 vekAekevetlmpgytHLqrAqPitlaHhllayaemlerDleRlldalkRvnksPlGsgAlagtsfei 205 +++Ae++ +t++pg+tH+q AqPit++Hh+lay+em+ rD eR++da kR+n+ PlG++Alagt+f+i lcl|FitnessBrowser__HerbieS:HSERO_RS14685 147 LDLAEQHADTILPGFTHMQVAQPITFGHHVLAYVEMFGRDAERMIDARKRINRLPLGAAALAGTTFPI 214 ******************************************************************** PP TIGR00838 206 drellaelLgFdavvensldavsdRDfiiEllsaaallmvhlsrlaEelilfsseEfgfvelsdevss 273 dr ++a++LgFd+v++nsldavsdRDf+iE+ + aal+m+h+sr++Eel+++ s +gf++++d++++ lcl|FitnessBrowser__HerbieS:HSERO_RS14685 215 DRLRVAKTLGFDDVCRNSLDAVSDRDFAIEFCAGAALVMTHISRMSEELVIWMSPRVGFIDIADRFCT 282 ******************************************************************** PP TIGR00838 274 gssimPqKKnpDvaEliRgktgrviGnltglltilKalPlaYnkDlqEdkealfdalktveellevvt 341 gssimPqKKnpDv El+Rgktgrv+G+l++llt++K++PlaYnkD qEdke+lfd+++t++++l++++ lcl|FitnessBrowser__HerbieS:HSERO_RS14685 283 GSSIMPQKKNPDVPELARGKTGRVNGHLIALLTLMKGQPLAYNKDNQEDKEPLFDTVDTLTDTLRIFA 350 ******************************************************************** PP TIGR00838 342 gllkelkvnkerleeaakknfalatdlAdylvrkGvPFReaheivGevvakaiekGkkleeltleelq 409 + + + v+ e ++ aa +++a+atdlAdylv+kG+PFR+ahe v ++v+++++kG +l +l+l+ l+ lcl|FitnessBrowser__HerbieS:HSERO_RS14685 351 DMARGISVKPEAMRAAALQGYATATDLADYLVKKGLPFRDAHEAVAHAVRTCVDKGCDLADLSLADLR 418 ******************************************************************** PP TIGR00838 410 klsekleedvlevldleeavekrdakGGtakeevekaieeakael 454 ++s + edv+ vl+le +v++rd +GGta+++v+ ai+++++el lcl|FitnessBrowser__HerbieS:HSERO_RS14685 419 AFSDLIGEDVFAVLTLEGSVAARDHIGGTAPKQVRAAIAQLRKEL 463 ****************************************99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (464 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.82 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory