Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate HSERO_RS12800 HSERO_RS12800 aspartate aminotransferase
Query= BRENDA::D2Z0I0 (402 letters) >FitnessBrowser__HerbieS:HSERO_RS12800 Length = 431 Score = 449 bits (1156), Expect = e-131 Identities = 220/393 (55%), Positives = 285/393 (72%), Gaps = 5/393 (1%) Query: 7 FPKVKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVANRPNVHG 66 FP++++LP YVF + ELK RR GEDI+D+ MGNPD HI++KL EVA RP+ HG Sbjct: 41 FPRIERLPPYVFNITAELKMAARRRGEDIIDMSMGNPDGATPPHIVEKLVEVAQRPDTHG 100 Query: 67 YSASKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGDTVIVPN 126 YS+SKGIPRLR+AI +Y+ RY V+ DP+ AI+TIG+KEG +HLMLA L+ GDTV+VPN Sbjct: 101 YSSSKGIPRLRRAIAHWYRSRYEVDFDPDSEAIVTIGSKEGLAHLMLATLDKGDTVLVPN 160 Query: 127 PTYPIHYYAPIICGGDAISVPILPEEDFPEVFLRRLYDLIKTSFRKPKAVVLSFPHNPTT 186 P+YPIH Y +I G + SV + P DF + R ++ S+ KPK ++L FP NPT Sbjct: 161 PSYPIHIYGAVIAGANIRSVRMSPGVDFFDELERA----VRESYPKPKMMILGFPSNPTA 216 Query: 187 LCVDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVAVELYSMSKG 246 CV+LEFF+ VVKLA++ I +VHD AYAD+ FDG+ PSI+QV GA +VAVE +++SK Sbjct: 217 QCVELEFFERVVKLAREHQILVVHDLAYADITFDGWKAPSIMQVPGAREVAVEFFTLSKS 276 Query: 247 FSMAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTPIQVASIIALESPYEVVEKNREIYRR 306 ++MAGWR+ F+VGN L+ LA +KSY DYG FTP+QVA+I ALE VE+ R Y R Sbjct: 277 YNMAGWRIGFMVGNARLVAALARIKSYHDYGSFTPVQVAAIAALEGDQSCVEEIRANYER 336 Query: 307 RRDVLVEGLNRVGWEVKKPKGSMFVWAKVPEEV-GMNSLDFSLFLLREAKVAVSPGIGFG 365 RR+VLV+GL+ GW V PK SM++WA++PE SL+F+ LL +AKV VSPGIGFG Sbjct: 337 RRNVLVKGLHEAGWMVDVPKASMYIWARIPEPYRQFGSLEFARILLEQAKVCVSPGIGFG 396 Query: 366 EYGEGYVRFALVENEHRIRQAVRGIKKALDKIK 398 EYG+ YVRFAL+ENE RIRQA+RGIK K Sbjct: 397 EYGDEYVRFALIENESRIRQAIRGIKAMFKNAK 429 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 547 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 431 Length adjustment: 31 Effective length of query: 371 Effective length of database: 400 Effective search space: 148400 Effective search space used: 148400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory