Align Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial; Beta-alanine-pyruvate aminotransferase 2; EC 2.6.1.44 (characterized)
to candidate HSERO_RS19685 HSERO_RS19685 4-aminobutyrate aminotransferase
Query= SwissProt::Q94AL9 (477 letters) >FitnessBrowser__HerbieS:HSERO_RS19685 Length = 456 Score = 191 bits (485), Expect = 4e-53 Identities = 136/422 (32%), Positives = 203/422 (48%), Gaps = 22/422 (5%) Query: 51 PPYTGP--SADVILSKRKEFLSPSMFCLYRKPLNIVDGKMQYLFDESGRRYLDAFAGIAV 108 P Y GP +A + LS R E ++ R P+ + D G ++D AG+ V Sbjct: 20 PTYPGPKTAAALELSARTESMARGGG---RMPIAMDQAFGVTFKDPDGNTFIDLSAGVGV 76 Query: 109 VNCGHCHPDVVEPVINQIKRLQHPTVLYLN---HAIADFSEALASKLPGDLKVVFFTNSG 165 + G C+P VVE + Q + L H + + A SE + L GD + FFT G Sbjct: 77 SSVGRCNPRVVEAIRKQSESLMHSMEVNSSKRTELAAKISEIMPDGLRGDC-ITFFTQGG 135 Query: 166 TEANELALMMAKLYTGCQDIVAVRNGYHGNAAATMGATGQSMWK--FNVVQNSVHHALNP 223 ++A E A+ AK TG I+A GYHG A+ T + ++ F V HA P Sbjct: 136 SDALEAAVKFAKRVTGRHQIIAFHGGYHGIWNASNALTTGTAYRKGFGPFMGGVIHAPYP 195 Query: 224 DPYRGVFGSD---GEKYAKDLQDLI---QYGTTGHIAGFICEAIQGVGGIVELAPGYLSA 277 YR F + E+ A + D + Y +A I E +QG GG V +P +L Sbjct: 196 YAYRFPFDTSHKSAEQIAGEYVDYLLNTPYTAADDVAAVIVEPVQGEGGYVPPSPEFLQI 255 Query: 278 AYDTVKKAGGLFIADEVQSGFARTGNFWGFEAHNVVPDIVTMAKGIGNGFPLGAVVTTPE 337 ++G L I DEVQ+G RTG W E V PD++T KGIG P+ +V + Sbjct: 256 LRKACDRSGALLIVDEVQAGAGRTGKMWAVEHSGVKPDMLTFGKGIGGDMPMAGLVMRSD 315 Query: 338 IAGVLTRRSYFNTFGGNSVSTTAGLAVLNVIEKEKLQ--ENAAMVGSYLKEKLTQLKEKH 395 +A + S NTF NS+S L +++++ +L A +G +E++ Sbjct: 316 LAAKIPDGSQPNTFAANSISAAVALTNISILQDPRLDLVNRAHTLGLEAQERIRSFNSPW 375 Query: 396 EIIGDVRGRGLMLGVELVSDRKLKTPATAETL-HIMDQMKELGVLIGKGGYFGNVFRITP 454 +G+VRGRGLM+G+ELV +R+ + P + E L +MD + GVL+ G + NV R+ P Sbjct: 376 --VGEVRGRGLMIGIELVENRETREPLSREKLGKLMDYVVGHGVLMIPCGRYTNVMRVMP 433 Query: 455 PL 456 L Sbjct: 434 SL 435 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 456 Length adjustment: 33 Effective length of query: 444 Effective length of database: 423 Effective search space: 187812 Effective search space used: 187812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory