Align 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) (characterized)
to candidate HSERO_RS20320 HSERO_RS20320 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
Query= reanno::HerbieS:HSERO_RS20320 (265 letters) >FitnessBrowser__HerbieS:HSERO_RS20320 Length = 265 Score = 527 bits (1358), Expect = e-155 Identities = 265/265 (100%), Positives = 265/265 (100%) Query: 1 MLLIPAIDLKDGHCVRLKQGDMDQATVFSEDPAEMALHWLKQGARRLHLVDLNGAFAGKP 60 MLLIPAIDLKDGHCVRLKQGDMDQATVFSEDPAEMALHWLKQGARRLHLVDLNGAFAGKP Sbjct: 1 MLLIPAIDLKDGHCVRLKQGDMDQATVFSEDPAEMALHWLKQGARRLHLVDLNGAFAGKP 60 Query: 61 KNEAAVKAILKAVASFAEENEVEEIPVQLGGGIRDLDTIERYLDDGLSYIIIGTAAVKNP 120 KNEAAVKAILKAVASFAEENEVEEIPVQLGGGIRDLDTIERYLDDGLSYIIIGTAAVKNP Sbjct: 61 KNEAAVKAILKAVASFAEENEVEEIPVQLGGGIRDLDTIERYLDDGLSYIIIGTAAVKNP 120 Query: 121 GFLHDACSAFPGQIIVGLDAKDGKVATDGWSKLSGHEVVDLAQKFEGYGCEAIVYTDIGR 180 GFLHDACSAFPGQIIVGLDAKDGKVATDGWSKLSGHEVVDLAQKFEGYGCEAIVYTDIGR Sbjct: 121 GFLHDACSAFPGQIIVGLDAKDGKVATDGWSKLSGHEVVDLAQKFEGYGCEAIVYTDIGR 180 Query: 181 DGMMGGVNIEATVRLAQAVTIPIIASGGVHNVGDVEALCRVEDEGIEAVICGRSIYEGTL 240 DGMMGGVNIEATVRLAQAVTIPIIASGGVHNVGDVEALCRVEDEGIEAVICGRSIYEGTL Sbjct: 181 DGMMGGVNIEATVRLAQAVTIPIIASGGVHNVGDVEALCRVEDEGIEAVICGRSIYEGTL 240 Query: 241 DLRSGQDRADELTRELEANRLSGSK 265 DLRSGQDRADELTRELEANRLSGSK Sbjct: 241 DLRSGQDRADELTRELEANRLSGSK 265 Lambda K H 0.318 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 265 Length adjustment: 25 Effective length of query: 240 Effective length of database: 240 Effective search space: 57600 Effective search space used: 57600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate HSERO_RS20320 HSERO_RS20320 (1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase)
to HMM TIGR00007 (hisA: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (EC 5.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00007.hmm # target sequence database: /tmp/gapView.12063.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00007 [M=231] Accession: TIGR00007 Description: TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-76 242.4 0.4 3.5e-76 241.9 0.4 1.2 1 lcl|FitnessBrowser__HerbieS:HSERO_RS20320 HSERO_RS20320 1-(5-phosphoribosy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS20320 HSERO_RS20320 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylidenea # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 241.9 0.4 3.5e-76 3.5e-76 1 229 [. 3 243 .. 3 245 .. 0.94 Alignments for each domain: == domain 1 score: 241.9 bits; conditional E-value: 3.5e-76 TIGR00007 1 iiPaiDlkeGkvvrlvqGdkdkktvysddpleaakkfeeegaellHvVDLdgAkegekknlevikkiv 68 +iPaiDlk+G++vrl qGd+d+ tv+s+dp+e+a ++ ++ga++lH+VDL+gA++g++kn+ ++k i+ lcl|FitnessBrowser__HerbieS:HSERO_RS20320 3 LIPAIDLKDGHCVRLKQGDMDQATVFSEDPAEMALHWLKQGARRLHLVDLNGAFAGKPKNEAAVKAIL 70 59*****************************************************************9 PP TIGR00007 69 eel..........evkvqvGGGiRsleavekllelgverviigtaavenpelvkellkelgsekivvs 126 +++ e++vq+GGGiR+l+++e++l+ g++++iigtaav+np +++++ +++ +i+v+ lcl|FitnessBrowser__HerbieS:HSERO_RS20320 71 KAVasfaeeneveEIPVQLGGGIRDLDTIERYLDDGLSYIIIGTAAVKNPGFLHDACSAFP-GQIIVG 137 8763333333333579********************************************9.99**** PP TIGR00007 127 lDakegevavkGWkekselslvelakkleelgleeiilTdiekdGtlsGvnveltkelvkeaevevia 194 lDak+g+va+ GW + s ++v+la+k+e +g+e+i++Tdi +dG++ Gvn+e+t +l++++++++ia lcl|FitnessBrowser__HerbieS:HSERO_RS20320 138 LDAKDGKVATDGWSKLSGHEVVDLAQKFEGYGCEAIVYTDIGRDGMMGGVNIEATVRLAQAVTIPIIA 205 ******************************************************************** PP TIGR00007 195 sGGvssiedvkalkk...lgvkgvivGkAlyegklklk 229 sGGv+++ dv+al + g+++vi+G+ +yeg+l+l+ lcl|FitnessBrowser__HerbieS:HSERO_RS20320 206 SGGVHNVGDVEALCRvedEGIEAVICGRSIYEGTLDLR 243 ***********998766689999***********9985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (265 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.78 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory