Align Histidinol-phosphate aminotransferase; EC 2.6.1.9 (characterized, see rationale)
to candidate HSERO_RS20335 HSERO_RS20335 histidinol-phosphate aminotransferase
Query= uniprot:A0A2R7PAQ8 (373 letters) >FitnessBrowser__HerbieS:HSERO_RS20335 Length = 372 Score = 355 bits (911), Expect = e-102 Identities = 196/359 (54%), Positives = 251/359 (69%), Gaps = 10/359 (2%) Query: 15 IRPDVRAMHSYVVQPSTGMLKMDAMENPFRLPAHLQAALGQRLGSVALNRYPGDRIADLK 74 IRP VR SY V + GM+K+DAMENP+ LPA L+ L QRL ++ LNRYP LK Sbjct: 21 IRPVVRGWQSYHVPSAEGMVKLDAMENPYLLPAELREQLAQRLAALELNRYPVPSYTALK 80 Query: 75 AALAQYAGMPEGYGIVLGNGSDELITLLALACAQPGTGQRATMLAPMPGFVMYPLSAQLQ 134 AA+ + G+P GY ++LGNGSDELITLL++ACAQPG T+LAP PGFVMY +SA++ Sbjct: 81 AAICKGLGVPAGYDVLLGNGSDELITLLSVACAQPG----RTILAPEPGFVMYGVSAKMA 136 Query: 135 GLDFVGVPLTPDFELDEPAMLAAIGQHRPAITYIAYPNNPTATLWDEGAVQRIIDAAGAQ 194 GL++VGVPL D LD PAMLAA+ H+P IT++ YPNNPT TL++ V RI++AA A Sbjct: 137 GLEYVGVPLCADLSLDLPAMLAAMEAHKPVITWLGYPNNPTGTLYEMADVLRIVEAA-AP 195 Query: 195 GGIVVMDEAYQPFASRTWIDRMRAEPARNAHVLLMRTLSKFGLAGVRLGYLIGPSAFVSE 254 G+VV+DEAYQPFA+ T M A P N +++LMRT+SK GLAG+RLGYL A + E Sbjct: 196 YGLVVVDEAYQPFAAST---LMPALPQHN-NLVLMRTVSKLGLAGIRLGYLSAAPALLRE 251 Query: 255 IDKVRPPYNVSVLNCEAALFALEHAEVFAAQAAEIRVERATLIAALRQMPGVEKCWDSEA 314 +DKVRPPYNV+VL AALF LEH +V AQAA +R R+ L A L + GV+ + S A Sbjct: 252 LDKVRPPYNVNVLTEAAALFMLEHLDVLQAQAARLRQARSALAAELAALDGVQ-VFPSAA 310 Query: 315 NMVLIRVADSAKAYEGMKNRKVLVKNVSTMHPLLANCLRLTVGNAEDNAQMLAALQASL 373 N +LIRV D+ K + +VLVKN MH LL NCLR+TV + ++NA LAAL+ +L Sbjct: 311 NFLLIRVPDADKVCASLLAHRVLVKNAGRMHVLLQNCLRITVSSDKENAMFLAALKTAL 369 Lambda K H 0.321 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 372 Length adjustment: 30 Effective length of query: 343 Effective length of database: 342 Effective search space: 117306 Effective search space used: 117306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate HSERO_RS20335 HSERO_RS20335 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.943.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-96 308.0 0.0 4.4e-96 307.7 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS20335 HSERO_RS20335 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS20335 HSERO_RS20335 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 307.7 0.0 4.4e-96 4.4e-96 2 347 .. 23 366 .. 22 368 .. 0.96 Alignments for each domain: == domain 1 score: 307.7 bits; conditional E-value: 4.4e-96 TIGR01141 2 ekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk..klhrYpdpqalelkealaky 67 + ++ ++ Y+ + +++vkL+++EnP+ + +++e+l ++l+ +l+rYp p+ ++lk+a+ k lcl|FitnessBrowser__HerbieS:HSERO_RS20335 23 PVVRGWQSYHVP----SAEGMVKLDAMENPYLLPAELREQLAQRLAalELNRYPVPSYTALKAAICKG 86 667788888884....55689************************9999******************* PP TIGR01141 68 lgvee.enillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedle 134 lgv + ++llgnGsdeli+ll a+++pg+++l++ep + mY vsak+ag e++ vpl +d + dl+ lcl|FitnessBrowser__HerbieS:HSERO_RS20335 87 LGVPAgYDVLLGNGSDELITLLSVACAQPGRTILAPEPGFVMYGVSAKMAGLEYVGVPLCADLSLDLP 154 **765279******************************************************999999 PP TIGR01141 135 avle.aakekvklvflasPnnPtGnllkreeiekvleeve.dalVVvDeAYieFseeasvlellaeyp 200 a+l+ +++k+ +++l +PnnPtG+l + +++ +++e+++ +lVVvDeAY F+ + + ++ l +++ lcl|FitnessBrowser__HerbieS:HSERO_RS20335 155 AMLAaMEAHKPVITWLGYPNNPTGTLYEMADVLRIVEAAApYGLVVVDEAYQPFAAS-TLMPALPQHN 221 999868999******************************66***************6.********** PP TIGR01141 201 nlvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkk 268 nlv +rT+SK+ LAg+R+Gy+ a +++ ++l+kvr+pynv++l+ +aa+ l++ d ++++ +++++ lcl|FitnessBrowser__HerbieS:HSERO_RS20335 222 NLVLMRTVSKLG-LAGIRLGYLSAAPALLRELDKVRPPYNVNVLTEAAALFMLEHLDVLQAQAARLRQ 288 **********86.******************************************************* PP TIGR01141 269 ererlleelkkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtr 336 r l +el++l+g++v++S aNF+li+v+ da++++ +ll ++++v++ + ++ ll++clRitv ++ lcl|FitnessBrowser__HerbieS:HSERO_RS20335 289 ARSALAAELAALDGVQVFPSAANFLLIRVP-DADKVCASLLAHRVLVKNAGRMHVLLQNCLRITVSSD 355 ******************************.************************************* PP TIGR01141 337 eenerllealk 347 +en ++l+alk lcl|FitnessBrowser__HerbieS:HSERO_RS20335 356 KENAMFLAALK 366 *********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.21 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory