Align histidinol-phosphate aminotransferase (EC 2.6.1.9) (characterized)
to candidate HSERO_RS23520 HSERO_RS23520 histidinol-phosphate aminotransferase
Query= reanno::psRCH2:GFF3234 (348 letters) >FitnessBrowser__HerbieS:HSERO_RS23520 Length = 360 Score = 474 bits (1221), Expect = e-138 Identities = 238/353 (67%), Positives = 275/353 (77%), Gaps = 6/353 (1%) Query: 1 MSKFWSPFVKDLVPYVPGEQPKLSKLVKLNTNENPYGPSPRAIAAMQAELNDSLRLYPDP 60 MSKFWSP V L PY PGEQPK+++LVKLNTNE+PYGPSP A+ A+ E++DSLRLYP+P Sbjct: 1 MSKFWSPIVSRLTPYTPGEQPKIARLVKLNTNESPYGPSPLALQAIAREVSDSLRLYPNP 60 Query: 61 NGERLKQAVADYY---GVQPAQVFVGNGSDEVLAHAFHGLFQHAGPLLFPDISYSFYPVY 117 + E LKQA+A + GV +VFVGNGSDEVLAHAFH L QH P+LFPDI+YSFYP Y Sbjct: 61 DAEPLKQAIARRHAADGVSVREVFVGNGSDEVLAHAFHALLQHGKPILFPDITYSFYPTY 120 Query: 118 CGLYGIAYETVALDEQFQIDVADY---NRPNGGIIFPNPNAPTGCLLALEAIERLLQANT 174 GLY + Y V L E F + DY + GGIIFPNPNAPTGCLL L +ER+LQ N Sbjct: 121 AGLYQVEYRAVPLAEDFTLRSEDYLGHGQAIGGIIFPNPNAPTGCLLGLADVERILQGNP 180 Query: 175 ETVVLVDEAYVDFGGESAIALVDRYPNLLVTQTLSKSRSLAGLRVGLAVGHPDLIEALER 234 E VV+VDEAY+DFGG+SAI LV RYPNLLV QTLSKSR+LAG+RVG AVGH DLI+ALER Sbjct: 181 ERVVVVDEAYIDFGGQSAIPLVQRYPNLLVVQTLSKSRALAGMRVGFAVGHADLIDALER 240 Query: 235 IKNSFNSYPLDRIAIAGAAAAFEDRAYFQQTCQQVIDSREAVVAAMQGLGFEVLPSAANF 294 +KNSFNSYPLDR AIAGA AA ED YF++TC VI SR A+ A + GLGF+VLPSAANF Sbjct: 241 VKNSFNSYPLDRPAIAGATAAIEDEDYFRKTCNMVIASRTALAAQLAGLGFQVLPSAANF 300 Query: 295 IFARHPQRDAATIAASLREQGVIVRHFKQRRIEQFLRITIGTPEQNQALLEAL 347 +F RHPQ DAA +AA+LR G+IVRHFK RI QFLRITIGT E L+EAL Sbjct: 301 LFVRHPQHDAAQLAAALRADGIIVRHFKSERISQFLRITIGTDEDCGVLVEAL 353 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 485 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 360 Length adjustment: 29 Effective length of query: 319 Effective length of database: 331 Effective search space: 105589 Effective search space used: 105589 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS23520 HSERO_RS23520 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.3988.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-96 308.4 0.0 3e-96 308.3 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS23520 HSERO_RS23520 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS23520 HSERO_RS23520 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 308.3 0.0 3e-96 3e-96 4 348 .. 9 355 .. 6 356 .. 0.95 Alignments for each domain: == domain 1 score: 308.3 bits; conditional E-value: 3e-96 TIGR01141 4 ikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk.klhrYpdpqalelkealakylg. 69 ++ l+pY+pg++ + vkLn+nE+P+gps+ +++a+ +e++ +l++Yp+p+a lk+a+a++ lcl|FitnessBrowser__HerbieS:HSERO_RS23520 9 VSRLTPYTPGEQPKIA-RLVKLNTNESPYGPSPLALQAIAREVSdSLRLYPNPDAEPLKQAIARRHAa 75 7899*****9766666.6*************************999*****************99888 PP TIGR01141 70 ..veeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedlea 135 v++ ++++gnGsde++ ++a+l+ g+ +l+++ tys Y+++a ++++e++ vpl+ed++ e+ lcl|FitnessBrowser__HerbieS:HSERO_RS23520 76 dgVSVREVFVGNGSDEVLAHAFHALLQHGKPILFPDITYSFYPTYAGLYQVEYRAVPLAEDFTLRSED 143 89***********************************************************9999999 PP TIGR01141 136 vleaakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlv 203 l + + + + + +Pn+PtG ll +++e++l+ + +VVvDeAYi+F ++ s+++l+++ypnl+ lcl|FitnessBrowser__HerbieS:HSERO_RS23520 144 YL-GHGQAIGGIIFPNPNAPTGCLLGLADVERILQGNPERVVVVDEAYIDFGGQ-SAIPLVQRYPNLL 209 99.88888999999**********************779**************7.************* PP TIGR01141 204 vlrTlSKafgLAglRvGyaianaeiiealekvrapyn...vsslaleaavaalrdsdkiektveevkk 268 v++TlSK+ +LAg+RvG+a+++a++i+ale+v++++n ++++a + a+aa++d+d+++kt + v++ lcl|FitnessBrowser__HerbieS:HSERO_RS23520 210 VVQTLSKSRALAGMRVGFAVGHADLIDALERVKNSFNsypLDRPAIAGATAAIEDEDYFRKTCNMVIA 277 *********************************87543339*************************** PP TIGR01141 269 ererlleelkkleglevyeSkaNFvlikvke.daeelleallekgiivRdlksaeglleeclRitvGt 335 +r+ l ++l+ l g++v +S aNF++++ ++ da++l+ al giivR++ks ++++lRit+Gt lcl|FitnessBrowser__HerbieS:HSERO_RS23520 278 SRTALAAQLAGL-GFQVLPSAANFLFVRHPQhDAAQLAAALRADGIIVRHFKSE--RISQFLRITIGT 342 ************.8****************99********************88..48********** PP TIGR01141 336 reenerllealke 348 +e++ l+eal++ lcl|FitnessBrowser__HerbieS:HSERO_RS23520 343 DEDCGVLVEALRR 355 *********9985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (360 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.31 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory