Align Acetolactate synthase large subunit; AHAS; EC 2.2.1.6; Acetohydroxy-acid synthase large subunit; ALS (uncharacterized)
to candidate HSERO_RS11350 HSERO_RS11350 pyruvate dehydrogenase
Query= curated2:Q7U5G1 (617 letters) >FitnessBrowser__HerbieS:HSERO_RS11350 Length = 564 Score = 197 bits (500), Expect = 1e-54 Identities = 167/564 (29%), Positives = 256/564 (45%), Gaps = 36/564 (6%) Query: 18 PQTISGAAALMDALRRHGVDTIFGYPGGAILPIYDALHIAESEGWVKHILVRHEQAGTHA 77 P T+ A L+D L GV IFG G A+ P+ DA+ + W+ VRHE+ A Sbjct: 2 PATV--ADILIDTLYEIGVRQIFGVVGDALNPLTDAIRRDKRIEWIG---VRHEEGAALA 56 Query: 78 ADAYARATGKVGVCFGTSGPGATNLVTGIATAQMDSVPMVVITGQVPRPAIGTDAFQETD 137 A A+ TG++ VC GT+GPGA +LV G+ A+ D P++ I+G VP GTD QE Sbjct: 57 AAGQAKLTGRLAVCCGTTGPGANHLVAGLYEARKDHAPVLAISGGVPAAHRGTDYLQENS 116 Query: 138 IFGITLPIVKHSWVVRDPADLGSIVAQAFLIAASGRPGPVLIDIPKDV-GQEQFNYVPVE 196 + + +S ++ P ++ QA A + R G ++IP DV G + VP Sbjct: 117 PELLFRDVAAYSQIITSPDQAPAVFHQAIAQAYAQR-GVAHLNIPADVIGAKTSGSVP-- 173 Query: 197 PGSVIPGGFHQPEPPLDAAVAAALDLIEQAQRPLLYVGGGAISACAHDSLRMLAERYQLP 256 S+ P P A + AA DLI A ++ G G A D + LA + Q P Sbjct: 174 --SLHTLRERTPLSPPAADIQAAADLINAAGSVAIFAGNGCRGAI--DEVLALASKLQAP 229 Query: 257 VTTTLMGKGAFDENDALSVGMLGMHGTAYANFAVTECDLLIAVGARFDDRVTGKLDTFAP 316 V T GK + +G +G+ G A A+ ++++ +G+ + F P Sbjct: 230 VMHTFRGKDLASYDHPHWIGGVGLIGGAPGTDALHAAEVMLMLGSDY------PYSEFLP 283 Query: 317 -RARVVHFEIDPAEIGKNRKADVAVLGDLGLSLARMVEISLQRTAEPRTAAWLERINTWK 375 +++V+ + +G+ + + G S+A V+ L+R A+L++ N + Sbjct: 284 TKSKVIQIDERGFVLGRRAPVTLGITG----SVAPAVQQLLERVEGKTDGAFLQQANAHR 339 Query: 376 DRYPLTIPPA------EGAIYPQEVLLAVRDLA-PDAIVTTDVGQHQMWAAQHLR-NGPR 427 +R+ + A I PQ V A+ DLA DA D G +W +R G + Sbjct: 340 ERWNAKLDSAAEIKRHHKKIKPQSVARAISDLADDDAAFVVDTGVVTLWCGNWIRQRGGQ 399 Query: 428 GWISSAGLGTMGFGMPAAMGAQVAMPDRQVVCIAGDASILMNIQELGTLAAYGLPVKVVI 487 ++S +G + A G Q +RQVV GD M + E T + LPVKVV+ Sbjct: 400 RILASFNNAAVGTSLGQANGIQALDRERQVVVAVGDGGFTMLLGEFMTSVEHRLPVKVVV 459 Query: 488 VNNHWQGMVRQWQESFYDERYSASDMLNGMPDFIALARSFGVDGVKITDRELLHRDLAAA 547 NN G+V E + S+ N PDF A AR+ G G + E L L Sbjct: 460 FNNREWGLVHLEMEEAGMPAFEGSEFPN--PDFAAFARACGGQGFSVRTPEELEGGLQQL 517 Query: 548 LQSPTPTMIDVHVRRGENCYPMVP 571 L +P P ++DV + E P++P Sbjct: 518 LAAPGPAVLDVFIDPDE--LPVMP 539 Lambda K H 0.320 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 915 Number of extensions: 51 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 617 Length of database: 564 Length adjustment: 37 Effective length of query: 580 Effective length of database: 527 Effective search space: 305660 Effective search space used: 305660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory