GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuA in Herbaspirillum seropedicae SmR1

Align 2-isopropylmalate synthase (EC 2.3.3.13) (characterized)
to candidate HSERO_RS17185 HSERO_RS17185 2-isopropylmalate synthase

Query= BRENDA::P9WQB3
         (644 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS17185 HSERO_RS17185
           2-isopropylmalate synthase
          Length = 567

 Score =  609 bits (1571), Expect = e-179
 Identities = 318/602 (52%), Positives = 407/602 (67%), Gaps = 57/602 (9%)

Query: 40  SMPVNRYRPFAEEVEPIRLRNRTWPDRVIDRAPLWCAVDLRDGNQALIDPMSPARKRRMF 99
           S P  +YRPF      I L +RTWP +VI+  P+W + DLRDGNQALI+PM+  RK R F
Sbjct: 4   SNPAAKYRPFPA----IDLPDRTWPSKVINTPPIWMSTDLRDGNQALIEPMNAERKLRFF 59

Query: 100 DLLVRMGYKEIEVGFPSASQTDFDFVREIIEQGAIPDDVTIQVLTQCRPELIERTFQACS 159
           +LL++ G KEIEVGFPSASQTDFDFVR++I +  IPDDVTI VLTQ R ELI RT ++  
Sbjct: 60  ELLLKTGLKEIEVGFPSASQTDFDFVRKLIVENRIPDDVTIIVLTQSREELIRRTIESLE 119

Query: 160 GAPRAIVHFYNSTSILQRRVVFRANRAEVQAIATDGARKCVEQAAKYPGTQWRFEYSPES 219
           GA +AIVH YNS +   R++VF  +R E++ IA  G R   E     PGT+WRFEYSPES
Sbjct: 120 GAKKAIVHLYNSVAPAFRKIVFNMSREEIKNIAVTGTRLVKELTDARPGTEWRFEYSPES 179

Query: 220 YTGTELEYAKQVCDAVGEVIAPTPERPIIFNLPATVEMTTPNVYADSIEWMSRNLANRES 279
           ++ TEL+++K++CDAV E    +PER +I NLP+TVE  TPNVYAD IEWM RNL +R S
Sbjct: 180 FSTTELDFSKEICDAVCETWGASPERKVILNLPSTVECATPNVYADQIEWMCRNLKDRAS 239

Query: 280 VILSLHPHNDRGTAVAAAELGFAAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQ 339
            I+S+HPHNDRGTAVA+AEL   AGADR+EGCLFGNGERTGNV LVTL LNL+++GV+P 
Sbjct: 240 TIISVHPHNDRGTAVASAELAVMAGADRVEGCLFGNGERTGNVDLVTLALNLYTQGVNPG 299

Query: 340 IDFSNIDEIRRTVEYCNQLPVHERHPYGGDLVYTAFSGSHQDAINKGLDAMKLDADAADC 399
           +DFS+ID +R+ VE CNQ+PVH RHPY GDLV+TAFSGSHQDAI KG    + DA     
Sbjct: 300 LDFSDIDVVRQVVEECNQIPVHPRHPYVGDLVFTAFSGSHQDAIKKGFAKQQPDA----- 354

Query: 400 DVDDMLWQVPYLPIDPRDVGRTYEAVIRVNSQSGKGGVAYIMKTDHGLSLPRRLQIEFSQ 459
                +W+VPYLPIDP D+GR+Y+AVIRVNSQSGKGG+AY+++ ++GL+LPRRLQIEFS+
Sbjct: 355 -----IWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGMAYLLEQEYGLALPRRLQIEFSR 409

Query: 460 VIQKIAEGTAGEGGEVSPKEMWDAFAEEYLAPVRPLERIRQHVDAADDDGGTTSITATVK 519
            IQ+ A+ T   G E++  ++   F  EYL  V P       +        + +I   + 
Sbjct: 410 AIQREADAT---GKEIAASDIHAIFQREYLERVEPYVYRAHRMSEDSSKAESINIEVDIV 466

Query: 520 INGVETEISGSGNGPLAAFVHALADVGFDVAVLDYYEHAMSAGDDAQAAAYVEASVTIAS 579
            NG    + GSGNGP+ AFVHAL   G D+ ++D++EHA+ AG DA+AA+Y+E  +  A 
Sbjct: 467 RNGQPVTVRGSGNGPIDAFVHAL---GLDIKLMDFHEHAIGAGADAKAASYIELRLNEA- 522

Query: 580 PAQPGEAGRHASDPVTIASPAQPGEAGRHASDPVTSKTVWGVGIAPSITTASLRAVVSAV 639
                                                T +GVGI  +I TAS +AV+SAV
Sbjct: 523 ------------------------------------PTGFGVGIDANIVTASFKAVLSAV 546

Query: 640 NR 641
           NR
Sbjct: 547 NR 548


Lambda     K      H
   0.317    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 929
Number of extensions: 31
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 644
Length of database: 567
Length adjustment: 37
Effective length of query: 607
Effective length of database: 530
Effective search space:   321710
Effective search space used:   321710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

Align candidate HSERO_RS17185 HSERO_RS17185 (2-isopropylmalate synthase)
to HMM TIGR00970 (leuA: 2-isopropylmalate synthase (EC 2.3.3.13))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00970.hmm
# target sequence database:        /tmp/gapView.17733.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00970  [M=564]
Accession:   TIGR00970
Description: leuA_yeast: 2-isopropylmalate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
   1.3e-247  808.8   0.0   1.5e-247  808.6   0.0    1.0  1  lcl|FitnessBrowser__HerbieS:HSERO_RS17185  HSERO_RS17185 2-isopropylmalate 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__HerbieS:HSERO_RS17185  HSERO_RS17185 2-isopropylmalate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  808.6   0.0  1.5e-247  1.5e-247       1     563 [.       6     550 ..       6     551 .. 0.96

  Alignments for each domain:
  == domain 1  score: 808.6 bits;  conditional E-value: 1.5e-247
                                  TIGR00970   1 pskkykpfkaiklsnrkwpdkvitraprwlsvdlrdGnqalidpmsverkkryfkllvriGfkeievg 68 
                                                p+ ky+pf ai l++r+wp kvi+  p w+s+dlrdGnqali+pm++erk r+f+ll++ G keievg
  lcl|FitnessBrowser__HerbieS:HSERO_RS17185   6 PAAKYRPFPAIDLPDRTWPSKVINTPPIWMSTDLRDGNQALIEPMNAERKLRFFELLLKTGLKEIEVG 73 
                                                889***************************************************************** PP

                                  TIGR00970  69 fpsasqtdfdfvreiieqglipddvtiqvltqsreelikrtvealsGakkaivhlynatsdlfrevvf 136
                                                fpsasqtdfdfvr++i ++ ipddvti vltqsreeli+rt+e+l+Gakkaivhlyn++++ fr++vf
  lcl|FitnessBrowser__HerbieS:HSERO_RS17185  74 FPSASQTDFDFVRKLIVENRIPDDVTIIVLTQSREELIRRTIESLEGAKKAIVHLYNSVAPAFRKIVF 141
                                                **************99999************************************************* PP

                                  TIGR00970 137 rasreevlalavegsklvrklvkdaaksketrwsfeyspesfsdtelefavevceavkeviepteerp 204
                                                ++sree+ ++av g++lv++l++    +++t+w+feyspesfs tel+f++e+c+av e +  ++er 
  lcl|FitnessBrowser__HerbieS:HSERO_RS17185 142 NMSREEIKNIAVTGTRLVKELTDA---RPGTEWRFEYSPESFSTTELDFSKEICDAVCETWGASPERK 206
                                                *******************99975...689************************************** PP

                                  TIGR00970 205 iifnlpatvevatpnvyadsieylstniaerekvilslhphndrGtavaaaelGllaGadrieGclfG 272
                                                +i+nlp+tve atpnvyad+ie++++n+ +r + i+s+hphndrGtava+ael ++aGadr+eGclfG
  lcl|FitnessBrowser__HerbieS:HSERO_RS17185 207 VILNLPSTVECATPNVYADQIEWMCRNLKDRASTIISVHPHNDRGTAVASAELAVMAGADRVEGCLFG 274
                                                ******************************************************************** PP

                                  TIGR00970 273 nGertGnvdlvtlalnlytqGvspnldfsdldeilrvvercnkipvherhpygGdlvvtafsGshqda 340
                                                nGertGnvdlvtlalnlytqGv+p ldfsd+d +++vve+cn+ipvh+rhpy Gdlv+tafsGshqda
  lcl|FitnessBrowser__HerbieS:HSERO_RS17185 275 NGERTGNVDLVTLALNLYTQGVNPGLDFSDIDVVRQVVEECNQIPVHPRHPYVGDLVFTAFSGSHQDA 342
                                                ******************************************************************** PP

                                  TIGR00970 341 ikkGldaldkkkaaadtlwkvpylpldpkdvgreyeavirvnsqsGkGGvayvlktdlGldlprrlqi 408
                                                ikkG+       ++ d++w+vpylp+dp d+gr y+avirvnsqsGkGG+ay+l +++Gl lprrlqi
  lcl|FitnessBrowser__HerbieS:HSERO_RS17185 343 IKKGFAK-----QQPDAIWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGMAYLLEQEYGLALPRRLQI 405
                                                ****964.....456889************************************************** PP

                                  TIGR00970 409 efssvvkdiadskGkelsskeisdlfkeeyllnveqlerislvdyaveddGteskvitavvki..kge 474
                                                efs++++  ad+ Gke+ +++i  +f+ eyl  ve++  ++ +    ++d +++++i+  v+i  +g+
  lcl|FitnessBrowser__HerbieS:HSERO_RS17185 406 EFSRAIQREADATGKEIAASDIHAIFQREYLERVEPYV-YRAHRM--SEDSSKAESINIEVDIvrNGQ 470
                                                *******************************9888774.455544..445555666666666644899 PP

                                  TIGR00970 475 kkdieGsGnGplsalvdaladllnvdvavadysehalgsGddakaasyvelsvrrasdaekatvwGvG 542
                                                 + + GsGnGp+ a+v+al     +d++++d+ eha+g+G dakaasy+el +++a      t +GvG
  lcl|FitnessBrowser__HerbieS:HSERO_RS17185 471 PVTVRGSGNGPIDAFVHALG----LDIKLMDFHEHAIGAGADAKAASYIELRLNEAP-----TGFGVG 529
                                                99****************95....7889************************99887.....89**** PP

                                  TIGR00970 543 iaedvtsaslravlsavnraa 563
                                                i++++ +as++avlsavnr +
  lcl|FitnessBrowser__HerbieS:HSERO_RS17185 530 IDANIVTASFKAVLSAVNRQI 550
                                                ******************965 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (564 nodes)
Target sequences:                          1  (567 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.02s 00:00:00.05 Elapsed: 00:00:00.04
# Mc/sec: 7.38
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory