Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC 2.3.1.89; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase (uncharacterized)
to candidate HSERO_RS10800 HSERO_RS10800 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
Query= curated2:A7HJ58 (249 letters) >FitnessBrowser__HerbieS:HSERO_RS10800 Length = 277 Score = 103 bits (256), Expect = 5e-27 Identities = 64/176 (36%), Positives = 94/176 (53%), Gaps = 28/176 (15%) Query: 98 DISKFNARIEPGAIIREYVEIGNNAVIMMGAVINLGAIIGEGTMIDMNTVIGARARIGKY 157 D +K R+ P A+ R IG N V++M + +N+GA + EGTM+D +G+ A+IGK Sbjct: 101 DFAKGGFRVVPPAVARHGSFIGRN-VVLMPSYVNIGAYVDEGTMVDTWATVGSAAQIGKN 159 Query: 158 CHIGAGSVIAGVVEPPSAQPVIIEDNVVIGANAVILEGVRVGEHSVVAAGAVVVEDVPPY 217 H+ G I GV+EP A PVIIEDN IGA + ++EGV + E+SV++ G + + Y Sbjct: 160 VHLSGGVGIGGVLEPVQAGPVIIEDNCFIGARSEVVEGVIIEENSVLSMGVYIGQSTKIY 219 Query: 218 -----------------TVVAGVPAK----------VIKKVDEKTISKTQLIEELR 246 V +P+K ++KKVD +T SKT + E LR Sbjct: 220 DRETGEVHYGRVPAGSVVVPGNLPSKDGKYSLYAAIIVKKVDAQTRSKTSINELLR 275 Lambda K H 0.318 0.137 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 277 Length adjustment: 25 Effective length of query: 224 Effective length of database: 252 Effective search space: 56448 Effective search space used: 56448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory