Align Homocitrate synthase; EC 2.3.3.14 (characterized)
to candidate HSERO_RS14210 HSERO_RS14210 homocitrate synthase
Query= SwissProt::P05342 (385 letters) >FitnessBrowser__HerbieS:HSERO_RS14210 Length = 376 Score = 426 bits (1094), Expect = e-124 Identities = 216/365 (59%), Positives = 279/365 (76%), Gaps = 1/365 (0%) Query: 4 VIIDDTTLRDGEQSAGVAFNADEKIAIARALAELGVPELEIGIPSMGEEEREVMHAIAGL 63 V I+DTTLRDGEQ+AGVAF A+EKI IARAL E+GVPE+EIGIP MG+ E EV+ AIA L Sbjct: 2 VTINDTTLRDGEQTAGVAFTAEEKIDIARALDEIGVPEMEIGIPIMGQAEIEVIQAIAAL 61 Query: 64 GLSSRLLAWCRLCDVDLAAARSTGVTMVDLSLPVSDLMLHHKLNRDRDWALREVARLVGE 123 L S+ + W R+C+ DLAAA +V+LS+PVSD+ + HKL RDRDW L ++ + + Sbjct: 62 PLRSKTMVWGRMCEADLAAAARCNADIVNLSMPVSDIHIQHKLQRDRDWVLAQIRHFLPK 121 Query: 124 ARMAGLEVCLGCEDASRADLEFVVQVGEVAQAAGARRLRFADTVGVMEPFGMLDRFRFLS 183 A G+EVCLG ED+SRADL+F+++V E AQAAGARR RFADT+G+++PF + R L Sbjct: 122 ALDLGMEVCLGGEDSSRADLDFMLRVIETAQAAGARRFRFADTLGLLDPFATYEVIRQLR 181 Query: 184 RRLDMELEVHAHDDFGLATANTLAAVMGGATHINTTVNGLGERAGNAALEECVLALKNLH 243 + +D+ELE+HAH+D GLATANTLAA+ GA+H+NTTVNGLGERAGNA LEE V+ L++LH Sbjct: 182 QEVDIELEMHAHNDLGLATANTLAAINAGASHVNTTVNGLGERAGNAPLEEVVMGLRHLH 241 Query: 244 GIDTGIDTRGIPAISALVERASGRQVAWQKSVVGAGVFTHEAGIHVDGLLKHRRNYEGLN 303 GI+T +DTR +PAIS LV +ASG+ VA KS+VG VFTHE+GIHVDGLLK+ NYE + Sbjct: 242 GIETQVDTRSLPAISRLVAKASGKAVAPNKSIVGEAVFTHESGIHVDGLLKNPANYEHFS 301 Query: 304 PDELGRSHSLVLGKHSGAHMVRNTYRDLGIELADWQSQALLGRIRAFSTRTKRRSPQPAE 363 P ELGRSH +VLGKHSG+ V++ + +GI L+D Q+QA+L RIR T + +P E Sbjct: 302 PAELGRSHHIVLGKHSGSRGVKDAFAKMGILLSDSQAQAMLMRIRD-HTMVAKAAPSEDE 360 Query: 364 LQDFY 368 L F+ Sbjct: 361 LTRFF 365 Lambda K H 0.320 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 376 Length adjustment: 30 Effective length of query: 355 Effective length of database: 346 Effective search space: 122830 Effective search space used: 122830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate HSERO_RS14210 HSERO_RS14210 (homocitrate synthase)
to HMM TIGR02660 (nifV: homocitrate synthase (EC 2.3.3.14))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02660.hmm # target sequence database: /tmp/gapView.19546.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02660 [M=365] Accession: TIGR02660 Description: nifV_homocitr: homocitrate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-165 536.6 4.2 2e-165 536.4 4.2 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS14210 HSERO_RS14210 homocitrate syntha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS14210 HSERO_RS14210 homocitrate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 536.4 4.2 2e-165 2e-165 2 364 .. 2 364 .. 1 365 [. 0.99 Alignments for each domain: == domain 1 score: 536.4 bits; conditional E-value: 2e-165 TIGR02660 2 vlinDttLRDGEqaagvaFsaeEKlaiAkaLdeaGvdelEvGipamgeeEraairaiaalglkarlla 69 v+inDttLRDGEq+agvaF+aeEK+ iA+aLde+Gv+e+E+Gip mg++E+++i+aiaal l++++++ lcl|FitnessBrowser__HerbieS:HSERO_RS14210 2 VTINDTTLRDGEQTAGVAFTAEEKIDIARALDEIGVPEMEIGIPIMGQAEIEVIQAIAALPLRSKTMV 69 89****************************************************************** PP TIGR02660 70 WcRlraedieaaaevGvkavdlsvpvsdlqleaklkkdrawvleelkelvslakeeglkvsvgaeDas 137 W R++++d++aaa++ + v+ls+pvsd+++++kl++dr+wvl+++++++ +a + g++v++g+eD+s lcl|FitnessBrowser__HerbieS:HSERO_RS14210 70 WGRMCEADLAAAARCNADIVNLSMPVSDIHIQHKLQRDRDWVLAQIRHFLPKALDLGMEVCLGGEDSS 137 ******************************************************************** PP TIGR02660 138 RadeeflvelaevakeagakRlRfaDtvgvldPfstyelvkalraalelelElHaHnDlGlAtAntla 205 Rad +f+ +++e+a++aga+R+RfaDt+g+ldPf+tye +++lr+++++elE+HaHnDlGlAtAntla lcl|FitnessBrowser__HerbieS:HSERO_RS14210 138 RADLDFMLRVIETAQAAGARRFRFADTLGLLDPFATYEVIRQLRQEVDIELEMHAHNDLGLATANTLA 205 ******************************************************************** PP TIGR02660 206 avkaGassvsvtvlGlGERAGnAaleevalalkellgldtgidlselkelsqlvakasgraleaqkav 273 a++aGas+v++tv+GlGERAGnA+leev+++l++l+g++t++d+++l+++s+lvakasg+a++++k++ lcl|FitnessBrowser__HerbieS:HSERO_RS14210 206 AINAGASHVNTTVNGLGERAGNAPLEEVVMGLRHLHGIETQVDTRSLPAISRLVAKASGKAVAPNKSI 273 ******************************************************************** PP TIGR02660 274 vGesvFaHEsGiHvdgllkdeatYesldPeevGrerelviGKHsgraaviealkelgleleeeeaeel 341 vGe+vF+HEsGiHvdgllk++a+Ye+++P+e+Gr++++v+GKHsg+++v++a++++g+ l++++a+++ lcl|FitnessBrowser__HerbieS:HSERO_RS14210 274 VGEAVFTHESGIHVDGLLKNPANYEHFSPAELGRSHHIVLGKHSGSRGVKDAFAKMGILLSDSQAQAM 341 ******************************************************************** PP TIGR02660 342 leavravaerlKrsleeeelaal 364 l ++r+++ +K +++e+el+++ lcl|FitnessBrowser__HerbieS:HSERO_RS14210 342 LMRIRDHTMVAKAAPSEDELTRF 364 ********************876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (376 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.79 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory