Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate HSERO_RS00950 HSERO_RS00950 diaminopimelate decarboxylase
Query= BRENDA::Q9KVL7 (417 letters) >FitnessBrowser__HerbieS:HSERO_RS00950 Length = 430 Score = 467 bits (1201), Expect = e-136 Identities = 233/430 (54%), Positives = 319/430 (74%), Gaps = 16/430 (3%) Query: 1 MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSV--------GDY 52 M +F+Y+ +G L AEQV LA LA Q+GTPLYVYS+A L ++ A+ + G Sbjct: 1 MSHFSYR-NGVLHAEQVSLATLAEQFGTPLYVYSKAALVENFSAYANACQQAGRADGGKG 59 Query: 53 PHLICYAVKANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEM 112 L+CY+VK+NSNL VLN L RLGSGFDIVS GEL RV+AAGGD KV+FSGVGK EM Sbjct: 60 GALVCYSVKSNSNLAVLNLLGRLGSGFDIVSGGELLRVVAAGGDARKVIFSGVGKGRDEM 119 Query: 113 KRALQLKIKCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKF 172 K AL+ I CFNVES PE+ RLN+VAG LG +A ISLR+NP+VDAKTHPYISTGL++NKF Sbjct: 120 KLALEHDILCFNVESIPEVARLNEVAGALGKRARISLRVNPNVDAKTHPYISTGLKENKF 179 Query: 173 GITFDRAAQVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHI 232 G+ ++ A YR A +LP+++V GIDCHIGSQL +P ++A D+++ ++D+L+AEGI I Sbjct: 180 GVAYEDALNCYRAAAALPHIEVVGIDCHIGSQLLDDSPLLEALDKIIDMVDALEAEGIPI 239 Query: 233 RHLDVGGGLGVVYRDELPPQPSEYAKALLDRLE-------RHRDLELIFEPGRAIAANAG 285 HLD+GGG+G+ Y DE P +Y + R++ + R ++++FEPGR++ NAG Sbjct: 240 HHLDIGGGIGIRYDDEQPVAIGDYLARVFARVDAWRASKYQGRPIQVMFEPGRSVVGNAG 299 Query: 286 VLVTKVEFLKHTEHKNFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEAQTYDLVGPVCE 345 +L+T+V++LKH E KNFA++DAAMNDL+RPA+Y+AW + ++ G+ + YD+VGPVCE Sbjct: 300 LLLTEVQYLKHGEGKNFAVVDAAMNDLMRPAMYEAWHGVKTVKENAGQPRIYDVVGPVCE 359 Query: 346 TSDFLGKDRDLVLQEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREEL 405 + D+L + R+L + EGDLLA+ S+GAYG TM+SNYNTR R AEV+VDG + +L+R RE Sbjct: 360 SGDWLARSRELAIGEGDLLALMSAGAYGMTMASNYNTRGRAAEVLVDGERAHLIRARENP 419 Query: 406 SSLWALESVL 415 + L+ALE ++ Sbjct: 420 ADLFALEKIV 429 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 499 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 430 Length adjustment: 32 Effective length of query: 385 Effective length of database: 398 Effective search space: 153230 Effective search space used: 153230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate HSERO_RS00950 HSERO_RS00950 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.17098.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-158 511.5 0.0 8.1e-158 511.2 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS00950 HSERO_RS00950 diaminopimelate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS00950 HSERO_RS00950 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 511.2 0.0 8.1e-158 8.1e-158 5 416 .. 7 426 .. 4 427 .. 0.95 Alignments for each domain: == domain 1 score: 511.2 bits; conditional E-value: 8.1e-158 TIGR01048 5 kdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafka...ees......lvlYAvKAnsnl 63 ++g l +e+v+l++lae+fgtPlYvy++++l e+++a+++a ++ + lv+Y vK+nsnl lcl|FitnessBrowser__HerbieS:HSERO_RS00950 7 RNGVLHAEQVSLATLAEQFGTPLYVYSKAALVENFSAYANACQQagrA-DggkggaLVCYSVKSNSNL 73 7899**********************************9999875541.13445679*********** PP TIGR01048 64 avlrllaeeGlgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelell 131 avl+ll ++G+g+d+vsgGEl r++aAg +a k++fsg+gk ++e++ ale++i ++nv+s+ e+++l lcl|FitnessBrowser__HerbieS:HSERO_RS00950 74 AVLNLLGRLGSGFDIVSGGELLRVVAAGGDARKVIFSGVGKGRDEMKLALEHDILCFNVESIPEVARL 141 ******************************************************************** PP TIGR01048 132 eeiakelgkkarvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIG 199 +e+a+ lgk+ar++lRvnp+vdakth+yisTGlke+KFG+++e+a++ y++a++l+++e+vGi++HIG lcl|FitnessBrowser__HerbieS:HSERO_RS00950 142 NEVAGALGKRARISLRVNPNVDAKTHPYISTGLKENKFGVAYEDALNCYRAAAALPHIEVVGIDCHIG 209 ******************************************************************** PP TIGR01048 200 SqildlepfveaaekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekea. 266 Sq+ld +p+ ea++k++++++ l++egi +++ld+GGG+gi+y++e+ ++ + +y + + +++ lcl|FitnessBrowser__HerbieS:HSERO_RS00950 210 SQLLDDSPLLEALDKIIDMVDALEAEGIPIHHLDIGGGIGIRYDDEQ-PVAIGDYLARVFARVDAWRa 276 ********************************************999.*******9999998876433 PP TIGR01048 267 ..elglklklilEpGRslvanagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkrl 332 +g+ ++++EpGRs+v+nag llt+V+++K+ e ++f++vDa+mndl+Rpa+Yea+h + ++k+ lcl|FitnessBrowser__HerbieS:HSERO_RS00950 277 skYQGRPIQVMFEPGRSVVGNAGLLLTEVQYLKHGEGKNFAVVDAAMNDLMRPAMYEAWHGVKTVKE- 343 3356779**********************************************************66. PP TIGR01048 333 eeeetetvdvvGplCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegka 400 ++ + +dvvGp+CEsgD la+ rel e Gdlla++saGAYg++m+snYn+r+r+aevlv++++a lcl|FitnessBrowser__HerbieS:HSERO_RS00950 344 NAGQPRIYDVVGPVCESGDWLARSRELAIGE-GDLLALMSAGAYGMTMASNYNTRGRAAEVLVDGERA 410 88889**********************9888.************************************ PP TIGR01048 401 rlirrretledllale 416 +lir re+ +dl+ale lcl|FitnessBrowser__HerbieS:HSERO_RS00950 411 HLIRARENPADLFALE 426 *************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (430 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 8.11 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory