Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate HSERO_RS01815 HSERO_RS01815 gamma-glutamyl kinase
Query= BRENDA::P0A7B5 (367 letters) >FitnessBrowser__HerbieS:HSERO_RS01815 Length = 372 Score = 299 bits (766), Expect = 7e-86 Identities = 165/363 (45%), Positives = 224/363 (61%), Gaps = 1/363 (0%) Query: 4 SQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYP 63 ++ L++K+G+S++T + L+ I Q AQL A G +V+V+SGA+A G + LG+ Sbjct: 8 AKRLIIKVGSSLVTNDGKGLDANAIARWAEQIAQLRALGKEVVLVSSGAVAEGMQRLGFE 67 Query: 64 ELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDTLRA 123 + P I Q AAVGQ L Q++E F + +H Q+LLT AD+ DRER+LNAR TL A Sbjct: 68 KRPTGIHHLQACAAVGQMGLAQIYETSFRKHDLHTAQVLLTHADLADRERYLNARSTLFA 127 Query: 124 LLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPRSNP 183 LL +VPVINEND V T EIK GDND L AL A L A+ L++LTDQ GL+TADPR +P Sbjct: 128 LLQLGVVPVINENDTVVTDEIKFGDNDTLGALVANLIEAEALIILTDQPGLFTADPRKDP 187 Query: 184 QAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPGVIG 243 A LI + D +L IAG + +G+G GGM TK+ AA A +G T+IA G + V+ Sbjct: 188 TATLISEARAGDPSLELIAGGTGTGIGRGGMLTKILAAKRAATSGAHTVIAWGREEQVLT 247 Query: 244 DVMEGISVGTLFHAQATPLENRKRWIFG-APPAGEITVDEGATAAILERGSSLLPKGIKS 302 + G ++GT +A+ L RK+W+ AG + +D GA + G SLLP G+ Sbjct: 248 RLAAGEAIGTQLNAETAQLTARKQWMADHLKTAGRVVLDAGAVQKLSLEGKSLLPIGVVE 307 Query: 303 VTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVHRD 362 V+G F RG+VI + GR IA G+S YNS RRI H S EI AILG+ P VHRD Sbjct: 308 VSGEFGRGDVITCVDENGRAIARGMSNYNSSDARRIIRHPSSEIQAILGFVEEPELVHRD 367 Query: 363 DMI 365 +++ Sbjct: 368 NLV 370 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 372 Length adjustment: 30 Effective length of query: 337 Effective length of database: 342 Effective search space: 115254 Effective search space used: 115254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS01815 HSERO_RS01815 (gamma-glutamyl kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.29577.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-134 435.0 1.6 1.4e-134 434.8 1.6 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS01815 HSERO_RS01815 gamma-glutamyl kin Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS01815 HSERO_RS01815 gamma-glutamyl kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 434.8 1.6 1.4e-134 1.4e-134 1 362 [. 9 370 .. 9 371 .. 0.99 Alignments for each domain: == domain 1 score: 434.8 bits; conditional E-value: 1.4e-134 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaek 68 kr+++K+Gss++t++ + l+++ +a+ +eq+a+l++ G+evv+vsSGava G+++Lg+++rp+ +++ lcl|FitnessBrowser__HerbieS:HSERO_RS01815 9 KRLIIKVGSSLVTNDGKGLDANAIARWAEQIAQLRALGKEVVLVSSGAVAEGMQRLGFEKRPTGIHHL 76 699************999************************************************** PP TIGR01027 69 QalaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtva 136 Qa aaVGQ L + ye++f +++l++aQ+LLt+adl++rerylNar+tl +ll+lgvvp++NENDtv lcl|FitnessBrowser__HerbieS:HSERO_RS01815 77 QACAAVGQMGLAQIYETSFRKHDLHTAQVLLTHADLADRERYLNARSTLFALLQLGVVPVINENDTVV 144 ******************************************************************** PP TIGR01027 137 veeikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgss 204 ++eikfGDNDtL alva+l+eA++L++ltd+ gL++adpr++p+A+li+e ++ + +l+ +ag++g+ lcl|FitnessBrowser__HerbieS:HSERO_RS01815 145 TDEIKFGDNDTLGALVANLIEAEALIILTDQPGLFTADPRKDPTATLISEARAGDPSLELIAGGTGTG 212 ******************************************************************** PP TIGR01027 205 vGTGGmrtKleaaelAsragveviiasgekpekiadlledaavgtlfeakkkklknrkqwilaaseak 272 +G GGm tK+ aa+ A+++g +++ia g++++ +++l++++a+gt+++a++++l +rkqw++ +++++ lcl|FitnessBrowser__HerbieS:HSERO_RS01815 213 IGRGGMLTKILAAKRAATSGAHTVIAWGREEQVLTRLAAGEAIGTQLNAETAQLTARKQWMADHLKTA 280 ******************************************************************** PP TIGR01027 273 GkiivdegaeeallekgksLlpagvvevegnFsrgevveilaeegqeigkglvnysseelekikglks 340 G++++d+ga+++l+ +gksLlp gvvev+g+F rg+v+++++e+g+ i++g++ny+s++ ++i +++s lcl|FitnessBrowser__HerbieS:HSERO_RS01815 281 GRVVLDAGAVQKLSLEGKSLLPIGVVEVSGEFGRGDVITCVDENGRAIARGMSNYNSSDARRIIRHPS 348 ******************************************************************** PP TIGR01027 341 eeiedvLgyekkeevvhrdnlv 362 +ei+++Lg+ ++ e vhrdnlv lcl|FitnessBrowser__HerbieS:HSERO_RS01815 349 SEIQAILGFVEEPELVHRDNLV 370 ********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 10.62 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory