Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate HSERO_RS18430 HSERO_RS18430 chorismate mutase
Query= SwissProt::P27603 (365 letters) >lcl|FitnessBrowser__HerbieS:HSERO_RS18430 HSERO_RS18430 chorismate mutase Length = 357 Score = 336 bits (861), Expect = 7e-97 Identities = 168/357 (47%), Positives = 239/357 (66%), Gaps = 6/357 (1%) Query: 5 DQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHI 64 D+L LR +ID++D +ILDL+++RAR AQEV VK + A +RPEREA VL+ Sbjct: 4 DKLLPLRQKIDAIDAQILDLLNQRARVAQEVGHVKAET-----NAPVFRPEREAQVLRRA 58 Query: 65 MELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPM 124 + N GPL ++ +FRE+MS+C ALE+ + VAYLGPEGTFS+ A + FGH++ Sbjct: 59 ADRNPGPLLGADIQTIFREVMSACRALEKRVVVAYLGPEGTFSEQAVYQQFGHAIEGLSC 118 Query: 125 AAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGE 184 +IDEVFR+ AG +FGVVP+ENS+EG +N TLD L+ + I GEV + +HH L+ Sbjct: 119 VSIDEVFRDAEAGTADFGVVPIENSSEGVINRTLDLLLQTTLTISGEVSIPVHHSLMTA- 177 Query: 185 TTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMA 244 + K + ITRI +H+Q+LAQC WL+ +YP++ER AV+SNA+AA+ + + AAIAG++A Sbjct: 178 SGKMEGITRICAHSQALAQCNAWLNQNYPSIERQAVASNAEAARMAGEDQSVAAIAGEIA 237 Query: 245 AQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFH 304 Q Y L + I+D P N TRF +IG P+G D+TSI++S+ NK GA++ LL P Sbjct: 238 GQKYNLQTVNAHIQDDPHNRTRFAVIGRLRTAPSGRDQTSIVLSVPNKAGAVYNLLAPLA 297 Query: 305 SNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYP 361 +G+ +TR E+RP+R G W Y F++D GH QD + LE++ A K+LGSYP Sbjct: 298 RHGVSMTRFESRPARMGAWEYYFYVDLEGHEQDEKVAQALEELRQNAAFFKLLGSYP 354 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 357 Length adjustment: 29 Effective length of query: 336 Effective length of database: 328 Effective search space: 110208 Effective search space used: 110208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS18430 HSERO_RS18430 (chorismate mutase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01807.hmm # target sequence database: /tmp/gapView.14948.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01807 [M=76] Accession: TIGR01807 Description: CM_P2: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-32 96.6 0.2 1.1e-31 95.2 0.2 1.8 1 lcl|FitnessBrowser__HerbieS:HSERO_RS18430 HSERO_RS18430 chorismate mutase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS18430 HSERO_RS18430 chorismate mutase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.2 0.2 1.1e-31 1.1e-31 1 76 [] 6 79 .. 6 79 .. 0.98 Alignments for each domain: == domain 1 score: 95.2 bits; conditional E-value: 1.1e-31 TIGR01807 1 LkelRnkiDaiDdrildLlseRaklakavgelKkksaseaviYRPeREaavlrrlkelnkGpLdqeavar 70 L +lR+kiDaiD++ildLl++Ra++a++vg++K + +a+++RPeREa+vlrr ++n+GpL +++ lcl|FitnessBrowser__HerbieS:HSERO_RS18430 6 LLPLRQKIDAIDAQILDLLNQRARVAQEVGHVKAE--TNAPVFRPEREAQVLRRAADRNPGPLLGADIQT 73 789********************************..999****************************** PP TIGR01807 71 ifrEim 76 ifrE+m lcl|FitnessBrowser__HerbieS:HSERO_RS18430 74 IFREVM 79 *****9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (76 nodes) Target sequences: 1 (357 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.53 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory