GapMind for Amino acid biosynthesis

 

Aligments for a candidate for trpB in Escherichia coli BW25113

Align candidate 15381 b1261 (tryptophan synthase subunit beta (NCBI))
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00263.hmm
# target sequence database:        /tmp/gapView.13421.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00263  [M=385]
Accession:   TIGR00263
Description: trpB: tryptophan synthase, beta subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
   1.6e-192  625.7   0.0   1.8e-192  625.5   0.0    1.0  1  lcl|FitnessBrowser__Keio:15381  b1261 tryptophan synthase subuni


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Keio:15381  b1261 tryptophan synthase subunit beta (NCBI)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  625.5   0.0  1.8e-192  1.8e-192       2     383 ..       8     389 ..       7     391 .. 0.99

  Alignments for each domain:
  == domain 1  score: 625.5 bits;  conditional E-value: 1.8e-192
                       TIGR00263   2 kfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiylkredllhtGa 80 
                                     +fgefGG yvp++l++al++le+a+ +a+kd+ef++++++llk+yagrpt+lt ++n++  ++ + +ylkredllh+Ga
  lcl|FitnessBrowser__Keio:15381   8 YFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALTKCQNITAGTN-TTLYLKREDLLHGGA 85 
                                     7************************************************************97.9************** PP

                       TIGR00263  81 hkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqklnvfrmellgakvvpvtsGsk 159
                                     hk+n++lgqallakr+Gk++iiaetGaGqhGva+a+a+allgl+c++ymGa+dverq++nvfrm+l+ga+v+pv+sGs+
  lcl|FitnessBrowser__Keio:15381  86 HKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSA 164
                                     ******************************************************************************* PP

                       TIGR00263 160 tlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeevkeqilekegrlPdaviacvGGGsnaiGifaa 238
                                     tlkda+nealrdW++s+e++hy+lG+a+GphP+P+ivrefq++igee+k+qile+egrlPdaviacvGGGsnaiG+fa+
  lcl|FitnessBrowser__Keio:15381 165 TLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGMFAD 243
                                     ******************************************************************************* PP

                       TIGR00263 239 fiedeeveligveagGkGidtekhaatlskGkeGvlhGaktkllqdedGqieeahsvsaGldypgvgPehaalaetgra 317
                                     fi++ +v ligve+gG+Gi+t +h+a l++G++G+ +G+k+ ++q+edGqiee++s+saGld+p+vgP+ha+l+ tgra
  lcl|FitnessBrowser__Keio:15381 244 FINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQHAYLNSTGRA 322
                                     ******************************************************************************* PP

                       TIGR00263 318 eyeaitdeealealkllskeeGiipalesshalaaleklapklk.kdeivvvnlsGrGdkdletvak 383
                                      y++itd+ealea+k+l+ +eGiipalesshala++ k++ + + k++++vvnlsGrGdkd++tv++
  lcl|FitnessBrowser__Keio:15381 323 DYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALKMMRENPdKEQLLVVNLSGRGDKDIFTVHD 389
                                     *************************************99987766*******************987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (385 nodes)
Target sequences:                          1  (397 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.30
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory