Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate 15930 b1812 para-aminobenzoate synthase component I (NCBI)
Query= curated2:P14953 (494 letters) >FitnessBrowser__Keio:15930 Length = 453 Score = 245 bits (626), Expect = 2e-69 Identities = 145/456 (31%), Positives = 244/456 (53%), Gaps = 26/456 (5%) Query: 36 FKRFEESSCCFLLESVEGGEKWARYSIIGKNPFLVVESYKNKTIIRERNGSQREVEGNPV 95 F R LL S ++R+ I+ P + ++ +T++ E + +P+ Sbjct: 22 FSRLSHLPWAMLLHSGYADHPYSRFDIVVAEPICTLTTFGKETVVSESE-KRTTTTDDPL 80 Query: 96 EIIKGIMGK--FKGANLPNLPRFNGGAVGYFGYDLIRHYENLPNVPEDDMGLPECHFMFT 153 ++++ ++ + + + +LP F GGA+G FGYDL R +E+LP + E D+ LP+ Sbjct: 81 QVLQQVLDRADIRPTHNEDLP-FQGGALGLFGYDLGRRFESLPEIAEQDIVLPDMAVGIY 139 Query: 154 DEVLVYDHLKQKIHIIVNLHVNGNIERAYISAVDRIKTIHREILDTRWKTADNSVLSYNK 213 D L+ DH + + ++ H + N RA++ + + L + W+ Sbjct: 140 DWALIVDHQRHTVSLLS--HNDVNARRAWLES-QQFSPQEDFTLTSDWQ----------- 185 Query: 214 KKNELAVTSNISKEDFCRNVLKAKQYIRDGDIFQVVLSQRLCVETNENPFNIYRALRVIN 273 SN+++E + + ++Y+ GD +QV L+QR + + + + L N Sbjct: 186 --------SNMTREQYGEKFRQVQEYLHSGDCYQVNLAQRFHATYSGDEWQAFLQLNQAN 237 Query: 274 PSPYMYYLKFGGYRIIGSSPEMLVRVENGIVETCPIAGTRKRGRTKEEDEALEKELLSDE 333 +P+ +L+ I+ SPE + +N ++T PI GT R +ED +L + Sbjct: 238 RAPFSAFLRLEQGAILSLSPERFILCDNSEIQTRPIKGTLPRLPDPQEDSKQAVKLANSA 297 Query: 334 KEIAEHVMLVDLGRNDIGRVSKFGTVAVKNLMHIERYSHVMHVVTNVQGEIREDKTPFDA 393 K+ AE++M+VDL RNDIGRV+ G+V V L +E + V H+V+ + ++ E D Sbjct: 298 KDRAENLMIVDLMRNDIGRVAVAGSVKVPELFVVEPFPAVHHLVSTITAQLPEQLHASDL 357 Query: 394 LMSILPAGTLSGAPKVRAMEIIDELETVKRGPYGGAIGYLSFNGNLDSCITIRTIILKDG 453 L + P G+++GAPKVRAMEIIDELE +R + G+IGYLSF GN+D+ ITIRT+ +G Sbjct: 358 LRAAFPGGSITGAPKVRAMEIIDELEPQRRNAWCGSIGYLSFCGNMDTSITIRTLTAING 417 Query: 454 KAYVQAGAGIVADSVPEREYEECYNKAMALLKAIEE 489 + + AG GIVADS E EY+E ++K +LK +E+ Sbjct: 418 QIFCSAGGGIVADSQEEAEYQETFDKVNRILKQLEK 453 Lambda K H 0.319 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 494 Length of database: 453 Length adjustment: 33 Effective length of query: 461 Effective length of database: 420 Effective search space: 193620 Effective search space used: 193620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory