Align Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 (uncharacterized)
to candidate 15969 b1851 phosphogluconate dehydratase (NCBI)
Query= curated2:A8AB39 (552 letters) >FitnessBrowser__Keio:15969 Length = 603 Score = 249 bits (637), Expect = 2e-70 Identities = 171/523 (32%), Positives = 267/523 (51%), Gaps = 49/523 (9%) Query: 27 EELRRPLIGVANSWNEIVPGHVHLDKVAEAVKAGI-------RMAGGTPLEFGTIAVCDG 79 + + R I + S+N+++ H + E ++ + ++AGG P A+CDG Sbjct: 61 KSMLRNNIAIITSYNDMLSAHQPYEHYPEIIRKALHEANAVGQVAGGVP------AMCDG 114 Query: 80 IAMGHEGMRYSLPSREVIADTVEIMVEAHRLDAVVMVTNCDKITPGFLLAAARL-EVPVI 138 + G +GM SL SREVIA + + + + D + + CDKI PG +AA +P + Sbjct: 115 VTQGQDGMELSLLSREVIAMSAAVGLSHNMFDGALFLGVCDKIVPGLTMAALSFGHLPAV 174 Query: 139 LINGGPMMPGVYGKERIDFKDLMERMNVLIKEGRTEELRKLEESALP--GPGSCAGLFTA 196 + GPM G+ KE++ R+ L EG+ + + LE A PG+C TA Sbjct: 175 FVPSGPMASGLPNKEKV-------RIRQLYAEGKVDRMALLESEAASYHAPGTCTFYGTA 227 Query: 197 NTMNMLSEAMGLMLPGASTVPAVEARRLWYAKLTGMRIVKMVEEG---LTPDKILTRKAL 253 NT M+ E MG+ LPG+S V R ++ +M G + K++ K + Sbjct: 228 NTNQMVVEFMGMQLPGSSFVHPDSPLRDALTAAAARQVTRMTGNGNEWMPIGKMIDEKVV 287 Query: 254 ENAIAVDMALGGSTNSVLHLEALAYELGIDLPLEVFDEISRKVPHIASISPSGRHFVVDL 313 N I +A GGSTN +HL A+A GI + + F ++S VP +A + P+G + Sbjct: 288 VNGIVALLATGGSTNHTMHLVAMARAAGIQINWDDFSDLSDVVPLMARLYPNGPADINHF 347 Query: 314 DRAGGIPAVLKELGEAGLIHKDALTV---------------TGKTVWENVKDAAVLDREV 358 AGG+P +++EL +AGL+H+D TV G+ W + + LD V Sbjct: 348 QAAGGVPVLVRELLKAGLLHEDVNTVAGFGLSRYTLEPWLNNGELDWREGAEKS-LDSNV 406 Query: 359 IRPLDNPYSPFGGLAILKGSLAPNGAVVKASAVKRELWKFKGVARVFDREEDAVKAIRGG 418 I + P+S GG +L G+L AV+K SAV E + A VF+ + D + A G Sbjct: 407 IASFEQPFSHHGGTKVLSGNL--GRAVMKTSAVPVENQVIEAPAVVFESQHDVMPAFEAG 464 Query: 419 EIEPGTVIVIRYEGPR--GGPGMREMLTATAAVMALGLGDKVALVTDGRFSGAT-RGPAI 475 ++ V+V+R++GP+ G P + +++ + L K+ALVTDGR SGA+ + P+ Sbjct: 465 LLDRDCVVVVRHQGPKANGMPELHKLMPPLGVL--LDRCFKIALVTDGRLSGASGKVPSA 522 Query: 476 GHVSPEAAAGGPIALVQDGDEIVIDIEKRRLDLLVDEKELEER 518 HV+PEA GG +A V+DGD I ++ + L LLVDE EL R Sbjct: 523 IHVTPEAYDGGLLAKVRDGDIIRVNGQTGELTLLVDEAELAAR 565 Lambda K H 0.319 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 808 Number of extensions: 52 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 552 Length of database: 603 Length adjustment: 36 Effective length of query: 516 Effective length of database: 567 Effective search space: 292572 Effective search space used: 292572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory