Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate Ga0059261_1675 Ga0059261_1675 acetylornithine deacetylase (ArgE)
Query= BRENDA::Q92Y75 (374 letters) >FitnessBrowser__Korea:Ga0059261_1675 Length = 395 Score = 275 bits (704), Expect = 1e-78 Identities = 151/373 (40%), Positives = 211/373 (56%), Gaps = 10/373 (2%) Query: 5 EILGKLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKEARGY 64 EIL LVGF +V N D++ W+R YL SHG+A + G + ++N+FATIG E G Sbjct: 16 EILRTLVGFPTVSRDSNLDLIHWVRDYLASHGVASVLTSGKDPGKANLFATIGSGEG-GI 74 Query: 65 IISGHMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMPLRRP 124 ++SGH DVVP W S+PF L L+GRGT DMKGF+AA LA VP LA+ L P Sbjct: 75 VLSGHSDVVPVDGQDWHSNPFVLEERDGLLFGRGTCDMKGFIAACLAKVPMLASANLNEP 134 Query: 125 LHLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLTVRGR 184 +HLA+S+DEE GC+G HMI L +P G ++GEPT M + HK +A V G Sbjct: 135 VHLAISFDEEIGCKGAGHMIEELVARGLRPRGCVVGEPTSMEPVIGHKTGSAYGCAVHGL 194 Query: 185 SGHSSRPDQGLNAIHGVAGVLTQAVAEADRLVGGPFEHV-FEPPYSSLQIGTVKGGQAVN 243 HSS G+NAI A ++ + A A RL H + P+S+L G ++GGQA N Sbjct: 195 EAHSSLAPYGVNAIFYAARLIARIEAIAARLRAEERRHPGYSVPFSTLSAGVIEGGQASN 254 Query: 244 IIPDSCEVEFEARAISGVDPAELLAPVRKTAE-------ALTTLGFEVEWQELSAYPALS 296 I+P C F+ R + DP ++A ++ + G +E P + Sbjct: 255 IVPALCRFRFDIRTLPWTDPDAIIAELQTYIDHELLPEMRAVHAGARIEITMNGRVPGFA 314 Query: 297 LEPDAPLAALLEELTGREALPA-VSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEYILI 355 ++ DAPL ++ L G A P V++G+EAGLFQ G+ I+CGPG I +AHKPDE++ + Sbjct: 315 IDADAPLTRHVQRLAGSNAEPGFVAFGSEAGLFQARGVPTILCGPGSIEQAHKPDEFVAL 374 Query: 356 DELMACRAMVEAL 368 D+L C ++ L Sbjct: 375 DQLARCEDFLDRL 387 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 395 Length adjustment: 30 Effective length of query: 344 Effective length of database: 365 Effective search space: 125560 Effective search space used: 125560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Ga0059261_1675 Ga0059261_1675 (acetylornithine deacetylase (ArgE))
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.29053.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-122 395.6 0.0 1.2e-122 395.4 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_1675 Ga0059261_1675 acetylornithine d Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_1675 Ga0059261_1675 acetylornithine deacetylase (ArgE) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 395.4 0.0 1.2e-122 1.2e-122 1 364 [. 16 387 .. 16 388 .. 0.96 Alignments for each domain: == domain 1 score: 395.4 bits; conditional E-value: 1.2e-122 TIGR01892 1 eilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtD 69 eil+ Lv+f++vs+ sn+dli++v+dyl+++gva d k nl+a+iG +g+gg+vlsGh+D lcl|FitnessBrowser__Korea:Ga0059261_1675 16 EILRTLVGFPTVSRDSNLDLIHWVRDYLASHGVASVLTSGKDP-GKANLFATIG--SGEGGIVLSGHSD 81 79*******************************9988888887.9*********..999********** PP TIGR01892 70 vvPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGa 138 vvPvd++ W s+pf L e+dg L+grGt+DmkGF+a+ La vp la a+L +P+hl++s+Dee+g++Ga lcl|FitnessBrowser__Korea:Ga0059261_1675 82 VVPVDGQDWHSNPFVLEERDGLLFGRGTCDMKGFIAACLAKVPMLASANLNEPVHLAISFDEEIGCKGA 150 ********************************************************************* PP TIGR01892 139 kklieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlv 204 ++ie l rp+ +vGePts+ +v hk + v+G e+hss + Gv+ai+ aa+l+ar++ lcl|FitnessBrowser__Korea:Ga0059261_1675 151 GHMIEELVargLRPRGCVVGEPTSMEPVIGHKTGSAYGCAVHGLEAHSSLAPYGVNAIFYAARLIARIE 219 *****9988999********************************************************* PP TIGR01892 205 aladklkredlee.aFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee. 271 a a +l+ e+ + ++ +p++tl G+++GG+a+ni++a C++ +++R++p dp+++ a+l++ ++ lcl|FitnessBrowser__Korea:Ga0059261_1675 220 AIAARLRAEERRHpGYSVPFSTLSAGVIEGGQASNIVPALCRFRFDIRTLPWTDPDAIIAELQTYIDHe 288 ******996555427***********************************************9988766 PP TIGR01892 272 ....vkekapgfevkveelsatpaleleedaelvalleklaGa..aaevvsygteagllqelGieavvl 334 +++ + g +++ + p++++++da+l + +++laG+ ++ v++g+eagl+q G++++++ lcl|FitnessBrowser__Korea:Ga0059261_1675 289 llpeMRAVHAGARIEITMNGRVPGFAIDADAPLTRHVQRLAGSnaEPGFVAFGSEAGLFQARGVPTILC 357 77667778888999999999**********************9656669******************** PP TIGR01892 335 GPGdidqahqpdeYveieelkrcrallerl 364 GPG+i+qah+pde+v +++l rc+++l rl lcl|FitnessBrowser__Korea:Ga0059261_1675 358 GPGSIEQAHKPDEFVALDQLARCEDFLDRL 387 ***************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (395 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.00 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory