Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate Ga0059261_1393 Ga0059261_1393 argininosuccinate synthase (EC 6.3.4.5)
Query= SwissProt::P59846 (400 letters) >FitnessBrowser__Korea:Ga0059261_1393 Length = 405 Score = 513 bits (1322), Expect = e-150 Identities = 253/401 (63%), Positives = 312/401 (77%), Gaps = 7/401 (1%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIAL-- 59 ++VLAYSGGLDTS+ILKWL++ Y+ EV+ FTAD+GQGEE+E AR+KAL G Sbjct: 7 RVVLAYSGGLDTSVILKWLQQEYQCEVVTFTADLGQGEELEPARQKALNAGVKPEHIFID 66 Query: 60 DLKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKG 119 DL+EEFVRDFVFPMMRA A+YEG YLLGTSIARPLI+K L+ IA+E A+A++HGATGKG Sbjct: 67 DLREEFVRDFVFPMMRANALYEGLYLLGTSIARPLISKRLIEIAKEVNADAVSHGATGKG 126 Query: 120 NDQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQ--EKPYSMDAN 177 NDQVRFEL+AYAL PDIKVIAPWREW R ++I +AE H I V + E P+S DAN Sbjct: 127 NDQVRFELSAYALNPDIKVIAPWREWDLTSRTKLIEFAEKHQIQVAKDKRGEAPFSTDAN 186 Query: 178 LLHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAA 237 LLH S EG VLEDPW E P +F T +PE+APD PEY+ ++F +GD A+NGE +SPA Sbjct: 187 LLHTSSEGKVLEDPWEEVPDYVFSRTVNPEDAPDTPEYITIDFEKGDGTALNGEAMSPAT 246 Query: 238 LLQRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQ 297 LL LN++G +HG+GR+D+VENRFVGMKSRG+YETPGGTI + A R +ES+TLDR H Sbjct: 247 LLAALNDLGRKHGIGRLDLVENRFVGMKSRGMYETPGGTIYHLAHRGIESITLDRGAAHL 306 Query: 298 RDMLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSL 357 +D L+P+YAEL+Y GFW+APERE LQA DH ++V G RLKLYKG VYVVGRK+P SL Sbjct: 307 KDELAPRYAELIYNGFWFAPEREMLQAAIDHSQQNVNGTVRLKLYKGGVYVVGRKSPNSL 366 Query: 358 YRQDLVSF-DEAGGYDQKDAEGFIKIQALRLRVRALVEREG 397 Y + +V+F D+ G YDQ+DA GFIK+ ALRLR+ L R+G Sbjct: 367 YSEKVVTFEDDQGAYDQRDAAGFIKLNALRLRL--LGRRDG 405 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 514 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 405 Length adjustment: 31 Effective length of query: 369 Effective length of database: 374 Effective search space: 138006 Effective search space used: 138006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Ga0059261_1393 Ga0059261_1393 (argininosuccinate synthase (EC 6.3.4.5))
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.25336.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-146 474.0 0.0 2.8e-146 473.8 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_1393 Ga0059261_1393 argininosuccinate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_1393 Ga0059261_1393 argininosuccinate synthase (EC 6.3.4.5) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 473.8 0.0 2.8e-146 2.8e-146 1 389 [. 7 400 .. 7 404 .. 0.97 Alignments for each domain: == domain 1 score: 473.8 bits; conditional E-value: 2.8e-146 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGae.kayvi.Dareefvk 66 +vvlaysGGlDtsv+lk+l+++ +ev+++t+d+Gq+ e+l+ +++kal+ G++ +++ i D reefv+ lcl|FitnessBrowser__Korea:Ga0059261_1393 7 RVVLAYSGGLDTSVILKWLQQEyQCEVVTFTADLGQG-EELEPARQKALNAGVKpEHIFIdDLREEFVR 74 69********************899***********9.9*************97466777358****** PP TIGR00032 67 dylfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdl 135 d++f+ ++ana+yeg Yll+t++aRpli+k+l+e+ak+ +a+av+hG+tgKGnDqvRFels ++lnpd+ lcl|FitnessBrowser__Korea:Ga0059261_1393 75 DFVFPMMRANALYEGLYLLGTSIARPLISKRLIEIAKEVNADAVSHGATGKGNDQVRFELSAYALNPDI 143 ********************************************************************* PP TIGR00032 136 kviaPvreleli.ReeeieyaaekGievpvek..ekaysiDenllgrsiEageLEdpsteppediyelv 201 kviaP+re++l+ R+++ie+a+++ i+v+ +k e ++s+D nll+ s E++ LEdp+ e p+ +++ + lcl|FitnessBrowser__Korea:Ga0059261_1393 144 KVIAPWREWDLTsRTKLIEFAEKHQIQVAKDKrgEAPFSTDANLLHTSSEGKVLEDPWEEVPDYVFSRT 212 ***********99***************99875579********************************* PP TIGR00032 202 kdpiektedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiYE 270 ++p++++ d+pe+++i+FekG alnge ++p +l+ ++n++++khG+Gr+D vE+R +g+KsR++YE lcl|FitnessBrowser__Korea:Ga0059261_1393 213 VNPEDAP-DTPEYITIDFEKGDGTALNGEAMSPATLLAALNDLGRKHGIGRLDLVENRFVGMKSRGMYE 280 *999888.************************************************************* PP TIGR00032 271 apalllLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaealdalikktqervtGtvrvk 339 +p+ ++ + Ah+ +e+ +l++ +++k+ +y+eliY+G+wf p++e+l+a+i+++q++v+Gtvr+k lcl|FitnessBrowser__Korea:Ga0059261_1393 281 TPGGTIYHLAHRGIESITLDRGAAHLKDELAPRYAELIYNGFWFAPEREMLQAAIDHSQQNVNGTVRLK 349 ********************************************************************* PP TIGR00032 340 lfkGnaivigrkseyslYdeelvsfek.dkefdqkdaiGfikirglqikvy 389 l+kG ++v+grks++slY+e+ v+fe + ++dq+da+Gfik+++l+ + lcl|FitnessBrowser__Korea:Ga0059261_1393 350 LYKGGVYVVGRKSPNSLYSEKVVTFEDdQGAYDQRDAAGFIKLNALRLRLL 400 **************************955689**************98765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (405 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.49 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory