Align Serine acetyltransferase; SAT; EC 2.3.1.30 (characterized)
to candidate Ga0059261_0153 Ga0059261_0153 Serine acetyltransferase
Query= SwissProt::Q06750 (217 letters) >FitnessBrowser__Korea:Ga0059261_0153 Length = 232 Score = 182 bits (463), Expect = 3e-51 Identities = 95/210 (45%), Positives = 141/210 (67%), Gaps = 7/210 (3%) Query: 10 IDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHALYKRKFYFLARLISQVSRFFTGIEI 69 +D++ +DPA RS E++L Y G+ A++ HR+AH LY+ +FLAR ++ SR+ TGI+I Sbjct: 9 LDSIRARDPAPRSRAEILL-YPGVWALFWHRVAHRLYRANLFFLARFVNHTSRWLTGIDI 67 Query: 70 HPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQGVTLGGTGKEK---GKRHPTIKDDAL 126 HPGA IGR FFIDHG VVIGET EIGN+VT++Q VTLGGT + GKRHPT+ D + Sbjct: 68 HPGARIGRNFFIDHGF-VVIGETAEIGNDVTIYQCVTLGGTSPDNGVAGKRHPTLMDGVI 126 Query: 127 IATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVGIPGRVVVQNGKKVRRDLNHQDLP 186 I +GA+VLG ITV ++IGA +VV DVP+ + +VGIP + + K ++D Sbjct: 127 IGSGAQVLGPITVNPRARIGANAVVTKDVPEGAVMVGIPAKATLVEADKWQKDF--VPYG 184 Query: 187 DPVADRFKSLEQQILELKAELEDRKERINQ 216 P ++ + Q++ ++ ELE ++R+++ Sbjct: 185 TPCSELYDPATQKLEIMRCELEAMRKRVDE 214 Lambda K H 0.323 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 217 Length of database: 232 Length adjustment: 22 Effective length of query: 195 Effective length of database: 210 Effective search space: 40950 Effective search space used: 40950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory