Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate Ga0059261_3644 Ga0059261_3644 cysteine synthase A
Query= BRENDA::P37887 (308 letters) >FitnessBrowser__Korea:Ga0059261_3644 Length = 306 Score = 327 bits (837), Expect = 3e-94 Identities = 168/300 (56%), Positives = 215/300 (71%), Gaps = 3/300 (1%) Query: 5 ANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVKDRIGLAMIEAAEKEGKLKA 64 AN+I E IGNTP +++ RL A+V++K E NPG S+KDRI L+M+EAAE +G LK Sbjct: 3 ANTILETIGNTPHIRIQRLFP--GAEVWVKSERSNPGGSIKDRIALSMVEAAEADGSLKP 60 Query: 65 GNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERRNLLRAYGAELVLTPGAEGMK 124 G TI+EPTSGNTG+GLAMVAA KG K ILVMP++MS+ERR L+ AYGA LTP +GMK Sbjct: 61 GGTIVEPTSGNTGVGLAMVAAVKGYKLILVMPESMSIERRRLMLAYGATFDLTPREKGMK 120 Query: 125 GAIKKAEELAEKH-GYFVPQQFNNPSNPEIHRQTTGKEIVEQFGDDQLDAFVAGIGTGGT 183 GAI++A E+ E G ++PQQF NP+N ++H +TT +EI+ F D +D + G+GTGG Sbjct: 121 GAIERAVEIVESTPGAWMPQQFENPANVDVHVKTTAQEILNDFADAPVDVIITGVGTGGH 180 Query: 184 ITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQGIGAGFVPDILNTEVYDEIFP 243 ITG E LK+++P++K+YAVEP SPV+SGG+PGPH IQGIGAGFVP L+T+ D Sbjct: 181 ITGVAETLKKSWPNLKVYAVEPELSPVISGGQPGPHPIQGIGAGFVPKNLHTDAIDGAIQ 240 Query: 244 VKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKKLGKGKKVLAIIPSNGERYLSTP 303 V A +YARRAAREEG+L GISSGA + A + L G +VL GERYLS P Sbjct: 241 VDAGNAKDYARRAAREEGLLVGISSGATLAAIAKKLPDLPAGSRVLGFNYDTGERYLSVP 300 Lambda K H 0.313 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 306 Length adjustment: 27 Effective length of query: 281 Effective length of database: 279 Effective search space: 78399 Effective search space used: 78399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate Ga0059261_3644 Ga0059261_3644 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.11900.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-120 388.4 0.0 1.2e-120 388.2 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_3644 Ga0059261_3644 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_3644 Ga0059261_3644 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 388.2 0.0 1.2e-120 1.2e-120 2 296 .. 7 300 .. 6 302 .. 0.97 Alignments for each domain: == domain 1 score: 388.2 bits; conditional E-value: 1.2e-120 TIGR01139 2 seliGntPlvrLnlaeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGi 70 e+iGntP +r+++ + aev vk e nP++s+kdrial+m+e ae +g lk+g tive+tsGntG+ lcl|FitnessBrowser__Korea:Ga0059261_3644 7 LETIGNTPHIRIQRLFP-GAEVWVKSERSNPGGSIKDRIALSMVEAAEADGSLKPGGTIVEPTSGNTGV 74 689**********5555.8************************************************** PP TIGR01139 71 alamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqf 139 +lamvaa +gyklil+mpe+ms+err+l+ ayGa + Lt+ ++gmkgaie+a e+ve+tp ++ +++qf lcl|FitnessBrowser__Korea:Ga0059261_3644 75 GLAMVAAVKGYKLILVMPESMSIERRRLMLAYGATFDLTPREKGMKGAIERAVEIVESTPGAW-MPQQF 142 ************************************************************999.***** PP TIGR01139 140 enpanpeihrkttapeilkdldgk.ldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsgg 207 enpan ++h ktta+eil+d+ ++ +d++++gvGtGG itGv+e+lk++ p++kv+aveP+ spv+sgg lcl|FitnessBrowser__Korea:Ga0059261_3644 143 ENPANVDVHVKTTAQEILNDFADApVDVIITGVGTGGHITGVAETLKKSWPNLKVYAVEPELSPVISGG 211 *********************9988******************************************** PP TIGR01139 208 kpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle 276 +pgph iqGigagf+Pk+L ++ id i+v+ +a ++arr a+eeG+lvGissGa++aa k +l lcl|FitnessBrowser__Korea:Ga0059261_3644 212 QPGPHPIQGIGAGFVPKNLHTDAIDGAIQVDAGNAKDYARRAAREEGLLVGISSGATLAAIAKKLPDLP 280 ***********************************************************9888888888 PP TIGR01139 277 kdkkivvilpdtgerYlsta 296 ++ +++ dtgerYls++ lcl|FitnessBrowser__Korea:Ga0059261_3644 281 AGSRVLGFNYDTGERYLSVP 300 ******************87 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (306 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.20 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory