Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Asp/Glu-ADT subunit C; EC 6.3.5.- (uncharacterized)
to candidate Ga0059261_0081 Ga0059261_0081 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (EC 6.3.5.-)
Query= curated2:Q2G4F4 (100 letters) >FitnessBrowser__Korea:Ga0059261_0081 Length = 95 Score = 130 bits (328), Expect = 3e-36 Identities = 68/100 (68%), Positives = 76/100 (76%), Gaps = 5/100 (5%) Query: 1 MSVDTATVAKIASLARIKVSEAELGAMVPELNGILAWVEQLGEVDVTGIEPMTAVIPNKQ 60 MSVDTATV K+ASLARI + +A +VPELN IL W+EQLGEVD + +EPMTAVIPN Sbjct: 1 MSVDTATVKKVASLARIAIDDAAAERLVPELNNILGWIEQLGEVDTSSVEPMTAVIPNTL 60 Query: 61 RLRDDVVNADPLTGGDMRDAVLANAPAPEHGFFGVPKVIE 100 RLRDDVV T G +RD VLANAP EHGFF VPKVIE Sbjct: 61 RLRDDVV-----TDGGIRDEVLANAPLAEHGFFTVPKVIE 95 Lambda K H 0.315 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 71 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 100 Length of database: 95 Length adjustment: 10 Effective length of query: 90 Effective length of database: 85 Effective search space: 7650 Effective search space used: 7650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.7 bits) S2: 39 (19.6 bits)
Align candidate Ga0059261_0081 Ga0059261_0081 (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (EC 6.3.5.-))
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00135.hmm # target sequence database: /tmp/gapView.13277.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00135 [M=93] Accession: TIGR00135 Description: gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-31 92.8 0.0 7.4e-31 92.6 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_0081 Ga0059261_0081 aspartyl/glutamyl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_0081 Ga0059261_0081 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C ( # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.6 0.0 7.4e-31 7.4e-31 1 93 [] 3 95 .] 3 95 .] 0.99 Alignments for each domain: == domain 1 score: 92.6 bits; conditional E-value: 7.4e-31 TIGR00135 1 iskeevkrlakLarlelseeeaekfaeeLkeilklveqlsevdtenvepmanplelsnklReDeveeslkr 71 +++++vk++a Lar++++++ ae+++ eL++il+ +eql evdt+ vepm+++++ + +lR+D v+++ r lcl|FitnessBrowser__Korea:Ga0059261_0081 3 VDTATVKKVASLARIAIDDAAAERLVPELNNILGWIEQLGEVDTSSVEPMTAVIPNTLRLRDDVVTDGGIR 73 6899******************************************************************* PP TIGR00135 72 keilknapekedgfikvPkile 93 +e+l+nap +e gf+ vPk++e lcl|FitnessBrowser__Korea:Ga0059261_0081 74 DEVLANAPLAEHGFFTVPKVIE 95 ********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (93 nodes) Target sequences: 1 (95 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 3.37 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory