Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate Ga0059261_1288 Ga0059261_1288 Aspartate/tyrosine/aromatic aminotransferase
Query= BRENDA::D2Z0I0 (402 letters) >FitnessBrowser__Korea:Ga0059261_1288 Length = 401 Score = 421 bits (1081), Expect = e-122 Identities = 202/398 (50%), Positives = 277/398 (69%), Gaps = 7/398 (1%) Query: 1 MSEEWMFPKVKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVAN 60 MSEE F ++K+LP YV A VN ++ R GEDI+DLGMGNPD+PP QH+IDKLCEVA Sbjct: 1 MSEE--FYRIKRLPPYVIAEVNGMRAAARAAGEDIIDLGMGNPDLPPPQHVIDKLCEVAQ 58 Query: 61 RPNVHGYSASKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGD 120 +P+ HGYS SKGIP LR+A ++Y RR+GV++DPE ++T+G+KEG + L A+ PGD Sbjct: 59 KPSAHGYSQSKGIPGLRRAQANYYGRRFGVDVDPESEVVVTMGSKEGLASLATAITAPGD 118 Query: 121 TVIVPNPTYPIHYYAPIICGGDAISVPILPEEDFPEVFLRRLYDLIKTSFRKPKAVVLSF 180 ++ PNP+YPIH + II G +VP P+E + E R + + +P +V+++ Sbjct: 119 VILAPNPSYPIHTFGFIIAGATIRAVPTTPDEHYFESLERAMNFTVP----RPSILVVNY 174 Query: 181 PHNPTTLCVDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVAVEL 240 P NPT VDL F++ +V AK+ +WI+ D AY++L +DG SILQV+GA DVA+E Sbjct: 175 PSNPTAETVDLAFYERLVAWAKENKVWIISDLAYSELYYDGKPTVSILQVKGAKDVAIEF 234 Query: 241 YSMSKGFSMAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTPIQVASIIALESPYEVVEKN 300 S+SK +SMAGWR+ F VGN+ LI + +KSYLDYG FTP+Q A+ AL P ++VE N Sbjct: 235 TSLSKTYSMAGWRIGFAVGNKQLIAAMTRVKSYLDYGAFTPVQAAACAALNGPQDIVEAN 294 Query: 301 REIYRRRRDVLVEGLNRVGWEVKKPKGSMFVWAKVPEEVG-MNSLDFSLFLLREAKVAVS 359 R++Y +RRDVLVE R GW++ P SMF WA +P + + SL+FS LL AKVAV+ Sbjct: 295 RQLYHKRRDVLVESFGRAGWDIPAPPASMFAWAPLPPALAHLGSLEFSKQLLSHAKVAVA 354 Query: 360 PGIGFGEYGEGYVRFALVENEHRIRQAVRGIKKALDKI 397 PG+G+GE GEG+VR A+VENE R+RQA R ++K L + Sbjct: 355 PGVGYGENGEGFVRIAMVENEQRLRQAARNVRKYLQSM 392 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 401 Length adjustment: 31 Effective length of query: 371 Effective length of database: 370 Effective search space: 137270 Effective search space used: 137270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory