Align 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) (characterized)
to candidate Ga0059261_1047 Ga0059261_1047 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16)
Query= reanno::Korea:Ga0059261_1047 (242 letters) >FitnessBrowser__Korea:Ga0059261_1047 Length = 242 Score = 466 bits (1198), Expect = e-136 Identities = 242/242 (100%), Positives = 242/242 (100%) Query: 1 VIVFPAIDLKAGQVVRLAEGDMTRATVYGENPAAQAEAFAKAGATHLHVVDLDAAFAGES 60 VIVFPAIDLKAGQVVRLAEGDMTRATVYGENPAAQAEAFAKAGATHLHVVDLDAAFAGES Sbjct: 1 VIVFPAIDLKAGQVVRLAEGDMTRATVYGENPAAQAEAFAKAGATHLHVVDLDAAFAGES 60 Query: 61 INGGAVAAILARFPGKVQLGGGIRNRASVERWIDMGVSRVVIGTAALEDPDFVREAAAAH 120 INGGAVAAILARFPGKVQLGGGIRNRASVERWIDMGVSRVVIGTAALEDPDFVREAAAAH Sbjct: 61 INGGAVAAILARFPGKVQLGGGIRNRASVERWIDMGVSRVVIGTAALEDPDFVREAAAAH 120 Query: 121 PGQIVVAVDARDGFVATKGWADVSTVSIAELGHRFEDAGVAALLFTDVGRDGLLKGCNVE 180 PGQIVVAVDARDGFVATKGWADVSTVSIAELGHRFEDAGVAALLFTDVGRDGLLKGCNVE Sbjct: 121 PGQIVVAVDARDGFVATKGWADVSTVSIAELGHRFEDAGVAALLFTDVGRDGLLKGCNVE 180 Query: 181 ATAALAAEVSIPVIASGGVADISDIHALAGKPGIEGVITGRALYDGRLDLAEALKAAAKV 240 ATAALAAEVSIPVIASGGVADISDIHALAGKPGIEGVITGRALYDGRLDLAEALKAAAKV Sbjct: 181 ATAALAAEVSIPVIASGGVADISDIHALAGKPGIEGVITGRALYDGRLDLAEALKAAAKV 240 Query: 241 AQ 242 AQ Sbjct: 241 AQ 242 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 242 Length adjustment: 23 Effective length of query: 219 Effective length of database: 219 Effective search space: 47961 Effective search space used: 47961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
Align candidate Ga0059261_1047 Ga0059261_1047 (1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16))
to HMM TIGR00007 (hisA: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (EC 5.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00007.hmm # target sequence database: /tmp/gapView.4458.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00007 [M=231] Accession: TIGR00007 Description: TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-81 257.4 0.9 7.2e-81 257.2 0.9 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_1047 Ga0059261_1047 1-(5-phosphoribos Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_1047 Ga0059261_1047 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 257.2 0.9 7.2e-81 7.2e-81 1 230 [. 3 232 .. 3 233 .. 0.98 Alignments for each domain: == domain 1 score: 257.2 bits; conditional E-value: 7.2e-81 TIGR00007 1 iiPaiDlkeGkvvrlvqGdkdkktvysddpleaakkfeeegaellHvVDLdgAkegekknlevikkive 69 ++PaiDlk G+vvrl +Gd+++ tvy+++p+++a++f++ ga+ lHvVDLd+A++ge n +++ i+ lcl|FitnessBrowser__Korea:Ga0059261_1047 3 VFPAIDLKAGQVVRLAEGDMTRATVYGENPAAQAEAFAKAGATHLHVVDLDAAFAGESINGGAVAAILA 71 79******************************************************************* PP TIGR00007 70 elevkvqvGGGiRsleavekllelgverviigtaavenpelvkellkelgsekivvslDakegevavkG 138 ++ kvq+GGGiR++++ve+++++gv+rv+igtaa+e+p++v+e++++ +ivv++Da++g va+kG lcl|FitnessBrowser__Korea:Ga0059261_1047 72 RFPGKVQLGGGIRNRASVERWIDMGVSRVVIGTAALEDPDFVREAAAAHP-GQIVVAVDARDGFVATKG 139 ********************************************999998.9***************** PP TIGR00007 139 WkekselslvelakkleelgleeiilTdiekdGtlsGvnveltkelvkeaeveviasGGvssiedvkal 207 W++ s++s++el +++e++g++++++Td+ +dG l+G nve+t l++e++++viasGGv++i+d++al lcl|FitnessBrowser__Korea:Ga0059261_1047 140 WADVSTVSIAELGHRFEDAGVAALLFTDVGRDGLLKGCNVEATAALAAEVSIPVIASGGVADISDIHAL 208 ********************************************************************9 PP TIGR00007 208 kk.lgvkgvivGkAlyegklklke 230 + g++gvi G+Aly+g+l+l e lcl|FitnessBrowser__Korea:Ga0059261_1047 209 AGkPGIEGVITGRALYDGRLDLAE 232 9758****************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (242 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.76 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory