Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate Ga0059261_1047 Ga0059261_1047 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16)
Query= curated2:Q5NMD5 (250 letters) >lcl|FitnessBrowser__Korea:Ga0059261_1047 Ga0059261_1047 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) Length = 242 Score = 305 bits (782), Expect = 4e-88 Identities = 155/239 (64%), Positives = 185/239 (77%), Gaps = 2/239 (0%) Query: 5 LIIFPAIDLKEGHVVRLSEGDMDRATIYDDDPAARARQFYEAGARYLHVVDLDGAFAGHA 64 +I+FPAIDLK G VVRL+EGDM RAT+Y ++PAA+A F +AGA +LHVVDLD AFAG + Sbjct: 1 VIVFPAIDLKAGQVVRLAEGDMTRATVYGENPAAQAEAFAKAGATHLHVVDLDAAFAGES 60 Query: 65 MNAAAVDAIVKAFPGTIELGGGIRDMNAIDGWLSRGISRVVIGTAAFENPDLVKEAAQKY 124 +N AV AI+ FPG ++LGGGIR+ +++ W+ G+SRVVIGTAA E+PD V+EAA + Sbjct: 61 INGGAVAAILARFPGKVQLGGGIRNRASVERWIDMGVSRVVIGTAALEDPDFVREAAAAH 120 Query: 125 PGQIVVAVDARDGMVTTKGWAEQSEISVTDMAERFADAGVVALLYTDVGRDGLKKGCNSE 184 PGQIVVAVDARDG V TKGWA+ S +S+ ++ RF DAGV ALL+TDVGRDGL KGCN E Sbjct: 121 PGQIVVAVDARDGFVATKGWADVSTVSIAELGHRFEDAGVAALLFTDVGRDGLLKGCNVE 180 Query: 185 ATLALAAATDIPVIASGGVKDIGDIELLARHTKDGIEGVICGRAIYDGSLDLKAALAIA 243 AT ALAA IPVIASGGV DI DI LA K GIEGVI GRA+YDG LDL AL A Sbjct: 181 ATAALAAEVSIPVIASGGVADISDIHALA--GKPGIEGVITGRALYDGRLDLAEALKAA 237 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 242 Length adjustment: 24 Effective length of query: 226 Effective length of database: 218 Effective search space: 49268 Effective search space used: 49268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
Align candidate Ga0059261_1047 Ga0059261_1047 (1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16))
to HMM TIGR00007 (hisA: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (EC 5.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00007.hmm # target sequence database: /tmp/gapView.32457.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00007 [M=231] Accession: TIGR00007 Description: TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-81 257.4 0.9 7.2e-81 257.2 0.9 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_1047 Ga0059261_1047 1-(5-phosphoribos Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_1047 Ga0059261_1047 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 257.2 0.9 7.2e-81 7.2e-81 1 230 [. 3 232 .. 3 233 .. 0.98 Alignments for each domain: == domain 1 score: 257.2 bits; conditional E-value: 7.2e-81 TIGR00007 1 iiPaiDlkeGkvvrlvqGdkdkktvysddpleaakkfeeegaellHvVDLdgAkegekknlevikkive 69 ++PaiDlk G+vvrl +Gd+++ tvy+++p+++a++f++ ga+ lHvVDLd+A++ge n +++ i+ lcl|FitnessBrowser__Korea:Ga0059261_1047 3 VFPAIDLKAGQVVRLAEGDMTRATVYGENPAAQAEAFAKAGATHLHVVDLDAAFAGESINGGAVAAILA 71 79******************************************************************* PP TIGR00007 70 elevkvqvGGGiRsleavekllelgverviigtaavenpelvkellkelgsekivvslDakegevavkG 138 ++ kvq+GGGiR++++ve+++++gv+rv+igtaa+e+p++v+e++++ +ivv++Da++g va+kG lcl|FitnessBrowser__Korea:Ga0059261_1047 72 RFPGKVQLGGGIRNRASVERWIDMGVSRVVIGTAALEDPDFVREAAAAHP-GQIVVAVDARDGFVATKG 139 ********************************************999998.9***************** PP TIGR00007 139 WkekselslvelakkleelgleeiilTdiekdGtlsGvnveltkelvkeaeveviasGGvssiedvkal 207 W++ s++s++el +++e++g++++++Td+ +dG l+G nve+t l++e++++viasGGv++i+d++al lcl|FitnessBrowser__Korea:Ga0059261_1047 140 WADVSTVSIAELGHRFEDAGVAALLFTDVGRDGLLKGCNVEATAALAAEVSIPVIASGGVADISDIHAL 208 ********************************************************************9 PP TIGR00007 208 kk.lgvkgvivGkAlyegklklke 230 + g++gvi G+Aly+g+l+l e lcl|FitnessBrowser__Korea:Ga0059261_1047 209 AGkPGIEGVITGRALYDGRLDLAE 232 9758****************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (242 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.74 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory