Align Histidinol-phosphate aminotransferase; Imidazole acetol phosphate aminotransferase; IAP aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 (characterized)
to candidate Ga0059261_2299 Ga0059261_2299 histidinol-phosphate aminotransferase
Query= SwissProt::P34037 (369 letters) >FitnessBrowser__Korea:Ga0059261_2299 Length = 376 Score = 462 bits (1190), Expect = e-135 Identities = 222/360 (61%), Positives = 276/360 (76%) Query: 8 RPKSWIDSIAPYIPGSSKTLDGRPAVKLSSNENPLGTSLKAKEAYREAIDSLSLYPDSGA 67 +PK WI IAPY+PG SKT DGR A+KLSSNENPLGTS KA+ A+ A +SL YPD+ A Sbjct: 9 QPKPWIMDIAPYVPGKSKTDDGRKAIKLSSNENPLGTSDKARAAFATAANSLERYPDASA 68 Query: 68 TALREAIGACYNLDPARIIHGTGSDEILHLAAGAYAGQDDEVLYPRYSFSVYPLAARRVG 127 LREA+ + LD ARII+G GSDE+LHLAAGA+AG DE++Y Y F+VYP+A +RVG Sbjct: 69 VELREALAELHGLDAARIIYGNGSDEVLHLAAGAFAGPGDEIIYVNYGFTVYPIATKRVG 128 Query: 128 ATPVEAPDDDYRCSVDALLKAVTPRTRVVFIANPNNPTGTWITRAEVEKLHNGLPRNCLL 187 ATPV A D DY VDA+L +VT RTR+VF+ANPNNPTGT+ +R E+ +LH GL + LL Sbjct: 129 ATPVVAADADYATDVDAILASVTDRTRIVFVANPNNPTGTYASREEIARLHAGLRPDILL 188 Query: 188 VIDQAYAEYLDPECDDGALALAKNTKNVLVTRTFSKIYGLAAERIGWAYACPEIIDALNR 247 V+D AYAEY++ E DDG + LAK NVLVTRTFSK+YGLAAERIGW Y E+I+A++R Sbjct: 189 VLDHAYAEYIEGEIDDGGMELAKTQPNVLVTRTFSKLYGLAAERIGWGYGSAEVIEAMHR 248 Query: 248 IRAPFNVTIAGQKAAVAALEDQAFIQNSFKHNKKWRGWFENQMALLSNAGIRVIPSSANF 307 IR PF++TIAG AA+AAL D AF++++ HN +WR WF +++A L NAG+R +PS ANF Sbjct: 249 IRLPFSITIAGTAAAIAALHDSAFVEHTRSHNAQWRRWFADEIAKLGNAGLRAVPSQANF 308 Query: 308 TLLLFEGSLTAETAYKALMDHGYTTRWLPGQRLPHALRITIGSEKHMQDVAGILTSLVRQ 367 L+LFEG+LTAE AYK LMD GY RWLPGQ LPH LRITIG+E+ + VA IL LV + Sbjct: 309 VLVLFEGALTAEAAYKGLMDEGYIVRWLPGQGLPHGLRITIGTEEETRAVAAILNKLVAE 368 Lambda K H 0.318 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 376 Length adjustment: 30 Effective length of query: 339 Effective length of database: 346 Effective search space: 117294 Effective search space used: 117294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Ga0059261_2299 Ga0059261_2299 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.17851.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-96 307.6 0.0 5.5e-96 307.4 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_2299 Ga0059261_2299 histidinol-phosph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_2299 Ga0059261_2299 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 307.4 0.0 5.5e-96 5.5e-96 4 348 .. 14 364 .. 11 365 .. 0.94 Alignments for each domain: == domain 1 score: 307.4 bits; conditional E-value: 5.5e-96 TIGR01141 4 ikklepYqpgarelgek.evvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakylgve 71 i +++pY+pg++++ + + +kL+snEnP+g+s+k+++a+ ++++l+rYpd++a+el+eala+ g++ lcl|FitnessBrowser__Korea:Ga0059261_2299 14 IMDIAPYVPGKSKTDDGrKAIKLSSNENPLGTSDKARAAFATAANSLERYPDASAVELREALAELHGLD 82 7899*****9433333358************************************************** PP TIGR01141 72 eenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavleaa 140 ++ i+ gnGsde+++l + af+ pgd+++++++ +++Y++ +k ga + v++++d d++a+l+ + lcl|FitnessBrowser__Korea:Ga0059261_2299 83 AARIIYGNGSDEVLHLAAGAFAGPGDEIIYVNYGFTVYPIATKRVGATPV-VAADADYATDVDAILASV 150 *******************************************9999876.445555579********* PP TIGR01141 141 kekvklvflasPnnPtGnllkreeiekvleeve.dalVVvDeAYieFsee...asvlellaeypnlvvl 205 ++++++vf+a+PnnPtG++ +reei ++ + + d l V+D+AY e+ e +el++ pn++v+ lcl|FitnessBrowser__Korea:Ga0059261_2299 151 TDRTRIVFVANPNNPTGTYASREEIARLHAGLRpDILLVLDHAYAEYIEGeidDGGMELAKTQPNVLVT 219 ********************************66**************98777789************* PP TIGR01141 206 rTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkererll 274 rT+SK++gLA+ R+G ++++ae+iea++++r p++++ +aa+aal+ds+++e+t ++++ r++ lcl|FitnessBrowser__Korea:Ga0059261_2299 220 RTFSKLYGLAAERIGWGYGSAEVIEAMHRIRLPFSITIAGTAAAIAALHDSAFVEHTRSHNAQWRRWFA 288 ********************************************************************* PP TIGR01141 275 eelkkle..glevyeSkaNFvlikvke..daeelleallekgiivRdlksaeglleeclRitvGtreen 339 +e++kl gl+ ++S+aNFvl+ ++ +ae++++ l+++g+ivR l + gl ++ lRit+Gt+ee+ lcl|FitnessBrowser__Korea:Ga0059261_2299 289 DEIAKLGnaGLRAVPSQANFVLVLFEGalTAEAAYKGLMDEGYIVRWLPGQ-GL-PHGLRITIGTEEET 355 ****98622688*************9999*******************988.85.************** PP TIGR01141 340 erllealke 348 +++ ++l++ lcl|FitnessBrowser__Korea:Ga0059261_2299 356 RAVAAILNK 364 **9999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (376 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.45 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory